BLASTX nr result
ID: Glycyrrhiza30_contig00016248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016248 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU37302.1 hypothetical protein TSUD_354580 [Trifolium subterran... 52 4e-06 OAO91738.1 hypothetical protein AXX17_AT5G47070 [Arabidopsis tha... 51 5e-06 XP_003626873.1 hypothetical protein MTR_8g011480 [Medicago trunc... 52 8e-06 >GAU37302.1 hypothetical protein TSUD_354580 [Trifolium subterraneum] Length = 178 Score = 52.4 bits (124), Expect = 4e-06 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -3 Query: 146 RSEWWVVDGEMHEIGDHVS------AS*ENTPTSAASS*GEQFMCRSRTLL 12 RSEWW+VDGEMHEIGDHV EN P EQFM R+R +L Sbjct: 52 RSEWWIVDGEMHEIGDHVPPRERFIIPRENIPNKRRKQLREQFMRRTRLVL 102 >OAO91738.1 hypothetical protein AXX17_AT5G47070 [Arabidopsis thaliana] Length = 105 Score = 50.8 bits (120), Expect = 5e-06 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 6/51 (11%) Frame = -3 Query: 146 RSEWWVVDGEMHEIGDHV------SAS*ENTPTSAASS*GEQFMCRSRTLL 12 +SEWW+VDGEMHEIGDHV + +N P EQFM R+R +L Sbjct: 50 KSEWWIVDGEMHEIGDHVPLRERFTIPRDNIPNKRRKQLREQFMRRTRLVL 100 >XP_003626873.1 hypothetical protein MTR_8g011480 [Medicago truncatula] AET01349.1 hypothetical protein MTR_8g011480 [Medicago truncatula] Length = 242 Score = 52.4 bits (124), Expect = 8e-06 Identities = 27/51 (52%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Frame = -3 Query: 146 RSEWWVVDGEMHEIGDHVS------AS*ENTPTSAASS*GEQFMCRSRTLL 12 RSEWW+VDGEMHEIGDHV EN P EQFM R+R +L Sbjct: 50 RSEWWIVDGEMHEIGDHVPPRERFVIPRENIPNKRRKQLREQFMRRTRLVL 100