BLASTX nr result
ID: Glycyrrhiza30_contig00016178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016178 (463 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB62219.1 hypothetical protein B456_009G406600 [Gossypium raimo... 74 9e-14 >KJB62219.1 hypothetical protein B456_009G406600 [Gossypium raimondii] Length = 174 Score = 74.3 bits (181), Expect = 9e-14 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 136 LGLQSALIAQLFDNSLSAFMCSAFRSYPFRAPFLKNMPQ 20 LGLQSALIAQLF+NSLSAF+CSAFRSYPFRAPFLK +PQ Sbjct: 18 LGLQSALIAQLFENSLSAFVCSAFRSYPFRAPFLKKIPQ 56