BLASTX nr result
ID: Glycyrrhiza30_contig00016046
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016046 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007145959.1 hypothetical protein PHAVU_006G001200g [Phaseolus... 53 3e-07 XP_012472400.1 PREDICTED: cysteine-rich and transmembrane domain... 53 5e-07 XP_016703581.1 PREDICTED: cysteine-rich and transmembrane domain... 53 5e-07 KRH17610.1 hypothetical protein GLYMA_13G003300 [Glycine max] KR... 50 4e-06 KOM51365.1 hypothetical protein LR48_Vigan09g002400 [Vigna angul... 50 5e-06 >XP_007145959.1 hypothetical protein PHAVU_006G001200g [Phaseolus vulgaris] ESW17953.1 hypothetical protein PHAVU_006G001200g [Phaseolus vulgaris] Length = 61 Score = 53.1 bits (126), Expect = 3e-07 Identities = 29/53 (54%), Positives = 31/53 (58%) Frame = +2 Query: 188 MSSGQSTAXXXXXXXXXXXXXXTKLETPQYPPQNPAAVETKSKGDGFWKGCCA 346 MSSGQST + PQYP QN + VETKSKGDGFWKGCCA Sbjct: 1 MSSGQSTTTAYPPPPPVGYPTQ---DIPQYP-QNSSMVETKSKGDGFWKGCCA 49 >XP_012472400.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Gossypium raimondii] KJB06162.1 hypothetical protein B456_001G092800 [Gossypium raimondii] Length = 78 Score = 53.1 bits (126), Expect = 5e-07 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 272 QYPPQNPAAVETKSKGDGFWKGCCA 346 +Y QNPAAVETKS+GDGFWKGCCA Sbjct: 42 EYSQQNPAAVETKSRGDGFWKGCCA 66 >XP_016703581.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Gossypium hirsutum] XP_017642451.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Gossypium arboreum] KHG22226.1 hypothetical protein F383_05778 [Gossypium arboreum] Length = 78 Score = 53.1 bits (126), Expect = 5e-07 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 272 QYPPQNPAAVETKSKGDGFWKGCCA 346 +Y QNPAAVETKS+GDGFWKGCCA Sbjct: 42 EYSQQNPAAVETKSRGDGFWKGCCA 66 >KRH17610.1 hypothetical protein GLYMA_13G003300 [Glycine max] KRH17611.1 hypothetical protein GLYMA_13G003300 [Glycine max] Length = 65 Score = 50.4 bits (119), Expect = 4e-06 Identities = 30/56 (53%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = +2 Query: 188 MSSGQSTAXXXXXXXXXXXXXX---TKLETPQYPPQNPAAVETKSKGDGFWKGCCA 346 MSSGQST TK E+PQYP ++ VETKSKGDGFWKGCCA Sbjct: 1 MSSGQSTTAYPPPSSAPAQPPIGYPTK-ESPQYPQKS--VVETKSKGDGFWKGCCA 53 >KOM51365.1 hypothetical protein LR48_Vigan09g002400 [Vigna angularis] Length = 60 Score = 50.1 bits (118), Expect = 5e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +2 Query: 263 ETPQYPPQNPAAVETKSKGDGFWKGCCA 346 + PQYP QN + +ETKSKGDGFWKGCCA Sbjct: 22 DIPQYP-QNSSIMETKSKGDGFWKGCCA 48