BLASTX nr result
ID: Glycyrrhiza30_contig00016026
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00016026 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006576783.1 PREDICTED: sigma factor binding protein 1, chloro... 59 9e-08 KYP46361.1 hypothetical protein KK1_032088 [Cajanus cajan] 57 2e-07 XP_003554126.1 PREDICTED: uncharacterized protein LOC100808231 [... 54 5e-06 KHN08877.1 hypothetical protein glysoja_029454 [Glycine soja] 54 5e-06 >XP_006576783.1 PREDICTED: sigma factor binding protein 1, chloroplastic-like [Glycine max] KHN30364.1 hypothetical protein glysoja_025855 [Glycine soja] KRH66773.1 hypothetical protein GLYMA_03G127800 [Glycine max] Length = 167 Score = 58.9 bits (141), Expect = 9e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 412 EPFDDGDVFTPLMVENISALLPASVFYESHQVDNHW 305 EP DD DVFTP M+ENISALLPASVFYES + NHW Sbjct: 133 EPLDDDDVFTPQMIENISALLPASVFYESPHL-NHW 167 >KYP46361.1 hypothetical protein KK1_032088 [Cajanus cajan] Length = 103 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 412 EPFDDGDVFTPLMVENISALLPASVFYESHQVDNHW 305 +PFDD DVFTP M++NISALLPA++FYES + NHW Sbjct: 69 DPFDDDDVFTPQMIDNISALLPATLFYESPHL-NHW 103 >XP_003554126.1 PREDICTED: uncharacterized protein LOC100808231 [Glycine max] KRG95105.1 hypothetical protein GLYMA_19G130400 [Glycine max] Length = 168 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 403 DDGDVFTPLMVENISALLPASVFYESHQVDNHW 305 DD DVFTP M+ENISALLPASVFYES + NHW Sbjct: 137 DDDDVFTPQMIENISALLPASVFYESPHL-NHW 168 >KHN08877.1 hypothetical protein glysoja_029454 [Glycine soja] Length = 171 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 403 DDGDVFTPLMVENISALLPASVFYESHQVDNHW 305 DD DVFTP M+ENISALLPASVFYES + NHW Sbjct: 140 DDDDVFTPQMIENISALLPASVFYESPHL-NHW 171