BLASTX nr result
ID: Glycyrrhiza30_contig00015880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00015880 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH56952.1 hypothetical protein GLYMA_05G029300 [Glycine max] 55 2e-06 XP_006579543.1 PREDICTED: uncharacterized protein LOC100817544 [... 55 2e-06 NP_001304495.1 uncharacterized protein LOC100817544 [Glycine max... 54 6e-06 >KRH56952.1 hypothetical protein GLYMA_05G029300 [Glycine max] Length = 356 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 367 IEGVVRCLTAEAKPCYLMTDVVEKLKIEVKGGN 269 IEGVV CLT EAK C+LMTDVV+K+KIEVKG N Sbjct: 323 IEGVVSCLTVEAKFCHLMTDVVDKIKIEVKGEN 355 >XP_006579543.1 PREDICTED: uncharacterized protein LOC100817544 [Glycine max] KHN48667.1 hypothetical protein glysoja_015815 [Glycine soja] KRH56951.1 hypothetical protein GLYMA_05G029300 [Glycine max] Length = 399 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 367 IEGVVRCLTAEAKPCYLMTDVVEKLKIEVKGGN 269 IEGVV CLT EAK C+LMTDVV+K+KIEVKG N Sbjct: 366 IEGVVSCLTVEAKFCHLMTDVVDKIKIEVKGEN 398 >NP_001304495.1 uncharacterized protein LOC100817544 [Glycine max] ACU18024.1 unknown [Glycine max] Length = 399 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 367 IEGVVRCLTAEAKPCYLMTDVVEKLKIEVKGGN 269 IEGVV CLT +AK C+LMTDVV+K+KIEVKG N Sbjct: 366 IEGVVSCLTVDAKFCHLMTDVVDKIKIEVKGEN 398