BLASTX nr result
ID: Glycyrrhiza30_contig00015756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00015756 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004501311.1 PREDICTED: uncharacterized protein LOC101490613 [... 77 3e-15 GAU23178.1 hypothetical protein TSUD_306260 [Trifolium subterran... 76 1e-14 AFK45857.1 unknown [Medicago truncatula] 75 1e-14 AFK45938.1 unknown [Lotus japonicus] 75 2e-14 XP_019437716.1 PREDICTED: uncharacterized protein LOC109343725 [... 75 2e-14 XP_003603422.1 transmembrane protein, putative [Medicago truncat... 75 3e-14 XP_019416182.1 PREDICTED: uncharacterized protein LOC109327476 [... 74 1e-13 XP_006578151.1 PREDICTED: uncharacterized protein LOC100784749 [... 73 1e-13 KRH52465.1 hypothetical protein GLYMA_06G069800 [Glycine max] 73 2e-13 NP_001237363.1 uncharacterized protein LOC100500138 [Glycine max... 73 2e-13 KZV47638.1 hypothetical protein F511_14424, partial [Dorcoceras ... 72 3e-13 KYP70179.1 hypothetical protein KK1_009390 [Cajanus cajan] 72 3e-13 KRH61789.1 hypothetical protein GLYMA_04G068100 [Glycine max] 73 3e-13 XP_002285027.1 PREDICTED: uncharacterized protein LOC100249120 i... 72 3e-13 KHN07090.1 hypothetical protein glysoja_023273 [Glycine soja] 73 4e-13 XP_016171870.1 PREDICTED: uncharacterized protein LOC107614157 [... 71 1e-12 XP_015937603.1 PREDICTED: uncharacterized protein LOC107463327 [... 71 1e-12 XP_008445193.1 PREDICTED: uncharacterized protein LOC103488297 i... 70 2e-12 XP_016900009.1 PREDICTED: uncharacterized protein LOC103488297 i... 70 2e-12 XP_012076604.1 PREDICTED: uncharacterized protein LOC105637663 [... 70 2e-12 >XP_004501311.1 PREDICTED: uncharacterized protein LOC101490613 [Cicer arietinum] Length = 225 Score = 77.4 bits (189), Expect = 3e-15 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSGVCTTPLHVTSSQL+ASEIFPVP+VKGLLYP Sbjct: 49 RVTCRSGVCTTPLHVTSSQLVASEIFPVPIVKGLLYP 85 >GAU23178.1 hypothetical protein TSUD_306260 [Trifolium subterraneum] Length = 218 Score = 75.9 bits (185), Expect = 1e-14 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSGVCTTP+HVTSSQL+ASE+FPVP++KGLLYP Sbjct: 42 RVTCRSGVCTTPIHVTSSQLVASEVFPVPIIKGLLYP 78 >AFK45857.1 unknown [Medicago truncatula] Length = 215 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQL+AS++FPVPLVKGLLYP Sbjct: 39 RVTCRSGLCTTPLHVTSSQLVASDVFPVPLVKGLLYP 75 >AFK45938.1 unknown [Lotus japonicus] Length = 223 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSGVCT PLHVTSSQLIASEIFPVP+VKGLLYP Sbjct: 48 RVTCRSGVCTNPLHVTSSQLIASEIFPVPVVKGLLYP 84 >XP_019437716.1 PREDICTED: uncharacterized protein LOC109343725 [Lupinus angustifolius] Length = 224 Score = 75.5 bits (184), Expect = 2e-14 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASE+FP+P+VKGLLYP Sbjct: 49 RVTCRSGMCTTPLHVTSSQLIASEVFPIPVVKGLLYP 85 >XP_003603422.1 transmembrane protein, putative [Medicago truncatula] AES73673.1 transmembrane protein, putative [Medicago truncatula] Length = 261 Score = 75.5 bits (184), Expect = 3e-14 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQL+AS++FPVPLVKGLLYP Sbjct: 85 RVTCRSGLCTTPLHVTSSQLVASDVFPVPLVKGLLYP 121 >XP_019416182.1 PREDICTED: uncharacterized protein LOC109327476 [Lupinus angustifolius] Length = 228 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSGVCTTPLHVTSSQLIASE+FP+P+VK LLYP Sbjct: 53 RVTCRSGVCTTPLHVTSSQLIASEVFPLPVVKALLYP 89 >XP_006578151.1 PREDICTED: uncharacterized protein LOC100784749 [Glycine max] KHN08121.1 hypothetical protein glysoja_032305 [Glycine soja] Length = 209 Score = 72.8 bits (177), Expect = 1e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASEIFPV +VKGLLYP Sbjct: 34 RVTCRSGMCTTPLHVTSSQLIASEIFPVVVVKGLLYP 70 >KRH52465.1 hypothetical protein GLYMA_06G069800 [Glycine max] Length = 228 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASEIFPV +VKGLLYP Sbjct: 53 RVTCRSGMCTTPLHVTSSQLIASEIFPVVVVKGLLYP 89 >NP_001237363.1 uncharacterized protein LOC100500138 [Glycine max] ACU15061.1 unknown [Glycine max] Length = 228 Score = 72.8 bits (177), Expect = 2e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASEIFPV +VKGLLYP Sbjct: 53 RVTCRSGMCTTPLHVTSSQLIASEIFPVVVVKGLLYP 89 >KZV47638.1 hypothetical protein F511_14424, partial [Dorcoceras hygrometricum] Length = 183 Score = 71.6 bits (174), Expect = 3e-13 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RV CRSG+CTTPLHVTSSQL+ASE+FP+P++KGLLYP Sbjct: 2 RVQCRSGMCTTPLHVTSSQLVASEVFPLPVIKGLLYP 38 >KYP70179.1 hypothetical protein KK1_009390 [Cajanus cajan] Length = 209 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASE+FPV +VKGLLYP Sbjct: 34 RVTCRSGMCTTPLHVTSSQLIASELFPVVVVKGLLYP 70 >KRH61789.1 hypothetical protein GLYMA_04G068100 [Glycine max] Length = 256 Score = 72.8 bits (177), Expect = 3e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASEIFPV +VKGLLYP Sbjct: 81 RVTCRSGMCTTPLHVTSSQLIASEIFPVVVVKGLLYP 117 >XP_002285027.1 PREDICTED: uncharacterized protein LOC100249120 isoform X1 [Vitis vinifera] CBI21016.3 unnamed protein product, partial [Vitis vinifera] Length = 210 Score = 72.0 bits (175), Expect = 3e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RV CRSG+CTTPL VTSSQLIASEIFPVPLVKGLLYP Sbjct: 35 RVPCRSGMCTTPLQVTSSQLIASEIFPVPLVKGLLYP 71 >KHN07090.1 hypothetical protein glysoja_023273 [Glycine soja] Length = 274 Score = 72.8 bits (177), Expect = 4e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG+CTTPLHVTSSQLIASEIFPV +VKGLLYP Sbjct: 53 RVTCRSGMCTTPLHVTSSQLIASEIFPVVVVKGLLYP 89 >XP_016171870.1 PREDICTED: uncharacterized protein LOC107614157 [Arachis ipaensis] Length = 230 Score = 70.9 bits (172), Expect = 1e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG CTTPLHVTSSQLI+SEIFPVP+VK LL+P Sbjct: 54 RVTCRSGTCTTPLHVTSSQLISSEIFPVPVVKALLFP 90 >XP_015937603.1 PREDICTED: uncharacterized protein LOC107463327 [Arachis duranensis] Length = 230 Score = 70.9 bits (172), Expect = 1e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RVTCRSG CTTPLHVTSSQLI+SEIFPVP+VK LL+P Sbjct: 54 RVTCRSGTCTTPLHVTSSQLISSEIFPVPVVKALLFP 90 >XP_008445193.1 PREDICTED: uncharacterized protein LOC103488297 isoform X4 [Cucumis melo] XP_008445194.1 PREDICTED: uncharacterized protein LOC103488297 isoform X5 [Cucumis melo] Length = 215 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 R++CRSG+CTTPLHVTSSQLIASE+FP P+VK LLYP Sbjct: 40 RISCRSGMCTTPLHVTSSQLIASEVFPAPVVKALLYP 76 >XP_016900009.1 PREDICTED: uncharacterized protein LOC103488297 isoform X3 [Cucumis melo] Length = 216 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 R++CRSG+CTTPLHVTSSQLIASE+FP P+VK LLYP Sbjct: 40 RISCRSGMCTTPLHVTSSQLIASEVFPAPVVKALLYP 76 >XP_012076604.1 PREDICTED: uncharacterized protein LOC105637663 [Jatropha curcas] KDP33616.1 hypothetical protein JCGZ_07187 [Jatropha curcas] Length = 216 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = +3 Query: 210 RVTCRSGVCTTPLHVTSSQLIASEIFPVPLVKGLLYP 320 RV CRSG+C++P+HVTSSQLIASEIFPVP+VKGLLYP Sbjct: 41 RVPCRSGMCSSPIHVTSSQLIASEIFPVPVVKGLLYP 77