BLASTX nr result
ID: Glycyrrhiza30_contig00015652
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00015652 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU51632.1 hypothetical protein TSUD_414560 [Trifolium subterran... 62 6e-09 XP_013443567.1 hypothetical protein MTR_0006s0110 [Medicago trun... 54 6e-07 >GAU51632.1 hypothetical protein TSUD_414560 [Trifolium subterraneum] Length = 269 Score = 62.0 bits (149), Expect = 6e-09 Identities = 39/79 (49%), Positives = 51/79 (64%) Frame = -2 Query: 376 RMDRIKAQLAALLQQPNFFRSSLLGVANSLQVTPRQPVQSPLTSSMAESSRSFDLRMAEY 197 + +RI A L LL++ N RSS GV NS T P QS S+AESSR + RMAE Sbjct: 22 QFNRIDALLETLLEKYNCPRSSSHGVVNSFNQT--LPFQS---KSVAESSRELNQRMAEI 76 Query: 196 SREIRETCTRVLNLLHKEI 140 S+EI+++CTR+ NLL +EI Sbjct: 77 SKEIKQSCTRITNLLQEEI 95 >XP_013443567.1 hypothetical protein MTR_0006s0110 [Medicago truncatula] KEH17592.1 hypothetical protein MTR_0006s0110 [Medicago truncatula] Length = 99 Score = 53.9 bits (128), Expect = 6e-07 Identities = 28/58 (48%), Positives = 37/58 (63%) Frame = -3 Query: 306 LVLRTRFK*LRDNQFSRPSPLPWLNRPDHLICVWLNIHEKSERRVQESSTSCTRRSML 133 +VL T+ K L+ + R S LPWL + D++ CVWLN+HEK E V E S C RR M+ Sbjct: 1 MVLGTQCKKLQYSH--RTSFLPWLKQTDNVACVWLNMHEKLESHVHEFSNCCKRRLMI 56