BLASTX nr result
ID: Glycyrrhiza30_contig00015140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00015140 (644 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004496791.1 PREDICTED: cysteine-rich receptor-like protein ki... 74 5e-12 XP_007143186.1 hypothetical protein PHAVU_007G050800g [Phaseolus... 72 2e-11 XP_014513325.1 PREDICTED: putative cysteine-rich receptor-like p... 71 5e-11 XP_006606027.1 PREDICTED: cysteine-rich repeat secretory protein... 70 8e-11 KHN15822.1 Cysteine-rich receptor-like protein kinase 25 [Glycin... 70 1e-10 XP_017414403.1 PREDICTED: putative cysteine-rich receptor-like p... 70 1e-10 KHN15820.1 Cysteine-rich receptor-like protein kinase 25 [Glycin... 66 2e-09 XP_017413199.1 PREDICTED: uncharacterized protein LOC108324780 [... 67 2e-09 XP_014628118.1 PREDICTED: cysteine-rich repeat secretory protein... 66 3e-09 XP_019452502.1 PREDICTED: cysteine-rich receptor-like protein ki... 65 4e-09 XP_019452501.1 PREDICTED: cysteine-rich receptor-like protein ki... 65 8e-09 XP_019452500.1 PREDICTED: cysteine-rich receptor-like protein ki... 64 1e-08 XP_019452499.1 PREDICTED: cysteine-rich receptor-like protein ki... 64 1e-08 XP_019452498.1 PREDICTED: cysteine-rich receptor-like protein ki... 64 1e-08 XP_016173608.1 PREDICTED: cysteine-rich receptor-like protein ki... 62 8e-08 XP_015941645.1 PREDICTED: putative cysteine-rich receptor-like p... 58 1e-06 >XP_004496791.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Cicer arietinum] Length = 307 Score = 73.6 bits (179), Expect = 5e-12 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVI+AFV+P+VAA VLFTFGIC+VMRKQA SMI +WRKTDF+ Sbjct: 264 EVIVAFVIPIVAATVLFTFGICTVMRKQAASMIHLWRKTDFN 305 >XP_007143186.1 hypothetical protein PHAVU_007G050800g [Phaseolus vulgaris] ESW15180.1 hypothetical protein PHAVU_007G050800g [Phaseolus vulgaris] Length = 350 Score = 72.4 bits (176), Expect = 2e-11 Identities = 32/42 (76%), Positives = 40/42 (95%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL FV+P+VAAMVLFTFGICSVMRKQA S+I++W+KT++S Sbjct: 307 EVILTFVIPIVAAMVLFTFGICSVMRKQAKSVIELWKKTNYS 348 >XP_014513325.1 PREDICTED: putative cysteine-rich receptor-like protein kinase 9 [Vigna radiata var. radiata] Length = 312 Score = 70.9 bits (172), Expect = 5e-11 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL FV+P+VAAMVLFTFGIC+VMRKQA S+IQ+W++T++S Sbjct: 269 EVILTFVIPIVAAMVLFTFGICTVMRKQAKSVIQLWKQTNYS 310 >XP_006606027.1 PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine max] KRG91211.1 hypothetical protein GLYMA_20G140000 [Glycine max] Length = 336 Score = 70.5 bits (171), Expect = 8e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL FV+P+VAAMVLFTFGIC VMRKQA S+ Q+WRKT++S Sbjct: 282 EVILTFVIPIVAAMVLFTFGICHVMRKQAKSLKQLWRKTNYS 323 >KHN15822.1 Cysteine-rich receptor-like protein kinase 25 [Glycine soja] Length = 855 Score = 70.5 bits (171), Expect = 1e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL FV+P+VAAMVLFTFGIC VMRKQA S+ Q+WRKT++S Sbjct: 801 EVILTFVIPIVAAMVLFTFGICHVMRKQAKSLKQLWRKTNYS 842 >XP_017414403.1 PREDICTED: putative cysteine-rich receptor-like protein kinase 9 [Vigna angularis] BAT94002.1 hypothetical protein VIGAN_08056700 [Vigna angularis var. angularis] Length = 330 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/42 (71%), Positives = 40/42 (95%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL FV+P+VAAMVLFTFGIC+VMRKQA ++IQ+W++T++S Sbjct: 287 EVILTFVIPIVAAMVLFTFGICTVMRKQAKNVIQLWKQTNYS 328 >KHN15820.1 Cysteine-rich receptor-like protein kinase 25 [Glycine soja] Length = 287 Score = 66.2 bits (160), Expect = 2e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EV L FV+P+VAAMVLFTFGICSVM+KQA S I+IWRKT Sbjct: 235 EVNLTFVIPIVAAMVLFTFGICSVMKKQAKSEIEIWRKT 273 >XP_017413199.1 PREDICTED: uncharacterized protein LOC108324780 [Vigna angularis] Length = 1896 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL FV+P+VAAMVLFTFGIC+VMRKQA ++IQ+W++T S Sbjct: 1189 EVILTFVIPIVAAMVLFTFGICTVMRKQAKNVIQLWKQTFIS 1230 >XP_014628118.1 PREDICTED: cysteine-rich repeat secretory protein 38-like [Glycine max] KRG91214.1 hypothetical protein GLYMA_20G140300 [Glycine max] Length = 335 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EV L FV+P+VAAMVLFTFGICSVM+KQA S I+IWRKT Sbjct: 283 EVNLTFVIPIVAAMVLFTFGICSVMKKQAKSEIEIWRKT 321 >XP_019452502.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X5 [Lupinus angustifolius] Length = 308 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL F +P+VAAMVLFTFGIC+ MRKQA +MIQ+W K++ S Sbjct: 265 EVILTFAIPIVAAMVLFTFGICAAMRKQARNMIQLWEKSNSS 306 >XP_019452501.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X4 [Lupinus angustifolius] Length = 309 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKTDFS 127 EVIL F +P+VAAMVLFTFGIC+ MRKQA +MIQ+W K+ S Sbjct: 265 EVILTFAIPIVAAMVLFTFGICAAMRKQARNMIQLWEKSQNS 306 >XP_019452500.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X3 [Lupinus angustifolius] Length = 311 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EVIL F +P+VAAMVLFTFGIC+ MRKQA +MIQ+W K+ Sbjct: 265 EVILTFAIPIVAAMVLFTFGICAAMRKQARNMIQLWEKS 303 >XP_019452499.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X2 [Lupinus angustifolius] Length = 312 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EVIL F +P+VAAMVLFTFGIC+ MRKQA +MIQ+W K+ Sbjct: 265 EVILTFAIPIVAAMVLFTFGICAAMRKQARNMIQLWEKS 303 >XP_019452498.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform X1 [Lupinus angustifolius] Length = 321 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EVIL F +P+VAAMVLFTFGIC+ MRKQA +MIQ+W K+ Sbjct: 265 EVILTFAIPIVAAMVLFTFGICAAMRKQARNMIQLWEKS 303 >XP_016173608.1 PREDICTED: cysteine-rich receptor-like protein kinase 25 [Arachis ipaensis] Length = 290 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EV LAFV+P+VAAMVLFTFGI S MRKQ +IQ+W+KT Sbjct: 248 EVFLAFVIPIVAAMVLFTFGIYSAMRKQGRDVIQLWKKT 286 >XP_015941645.1 PREDICTED: putative cysteine-rich receptor-like protein kinase 9 [Arachis duranensis] Length = 316 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +2 Query: 2 EVILAFVVPVVAAMVLFTFGICSVMRKQATSMIQIWRKT 118 EV+L V+P+VAAMVLFTFGICS M KQ +I++W+KT Sbjct: 274 EVVLGCVIPIVAAMVLFTFGICSAMGKQGRDVIKLWKKT 312