BLASTX nr result
ID: Glycyrrhiza30_contig00014971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014971 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP48392.1 putative serine/threonine-protein kinase WNK5 [Cajanu... 57 3e-07 XP_014630467.1 PREDICTED: probable serine/threonine-protein kina... 57 4e-07 XP_003517007.1 PREDICTED: probable serine/threonine-protein kina... 57 4e-07 KHN14259.1 Putative serine/threonine-protein kinase WNK5 [Glycin... 57 4e-07 AFK46161.1 unknown [Lotus japonicus] 51 1e-05 >KYP48392.1 putative serine/threonine-protein kinase WNK5 [Cajanus cajan] Length = 632 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 313 EETHKRRMFKTVGSIENIGFQNP*GAGGCFSH 218 EE HKRRMFKTVG+IENIGFQNP G GGCFS+ Sbjct: 602 EEIHKRRMFKTVGAIENIGFQNPEG-GGCFSY 632 >XP_014630467.1 PREDICTED: probable serine/threonine-protein kinase WNK5 isoform X2 [Glycine max] KRH76108.1 hypothetical protein GLYMA_01G132000 [Glycine max] Length = 594 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 313 EETHKRRMFKTVGSIENIGFQNP*GAGGCFSH 218 EE HKRRMFKTVG++ENIGFQNP G GGCFS+ Sbjct: 564 EEIHKRRMFKTVGAVENIGFQNPEG-GGCFSY 594 >XP_003517007.1 PREDICTED: probable serine/threonine-protein kinase WNK5 isoform X1 [Glycine max] KRH76107.1 hypothetical protein GLYMA_01G132000 [Glycine max] Length = 609 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 313 EETHKRRMFKTVGSIENIGFQNP*GAGGCFSH 218 EE HKRRMFKTVG++ENIGFQNP G GGCFS+ Sbjct: 579 EEIHKRRMFKTVGAVENIGFQNPEG-GGCFSY 609 >KHN14259.1 Putative serine/threonine-protein kinase WNK5 [Glycine soja] Length = 616 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 313 EETHKRRMFKTVGSIENIGFQNP*GAGGCFSH 218 EE HKRRMFKTVG++ENIGFQNP G GGCFS+ Sbjct: 586 EEIHKRRMFKTVGAVENIGFQNPEG-GGCFSY 616 >AFK46161.1 unknown [Lotus japonicus] Length = 138 Score = 50.8 bits (120), Expect = 1e-05 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 313 EETHKRRMFKTVGSIENIGFQNP*GAGGCF 224 EE HKRRMFKTVGSIENIGFQNP GG F Sbjct: 111 EEMHKRRMFKTVGSIENIGFQNP--EGGAF 138