BLASTX nr result
ID: Glycyrrhiza30_contig00014396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014396 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019457348.1 PREDICTED: SUPPRESSOR OF GAMMA RESPONSE 1-like is... 61 8e-09 XP_019457347.1 PREDICTED: SUPPRESSOR OF GAMMA RESPONSE 1-like is... 61 8e-09 KYP44011.1 NAC domain-containing protein 8 [Cajanus cajan] 61 8e-09 KHN27473.1 NAC domain-containing protein 8 [Glycine soja] 58 6e-08 XP_006579788.1 PREDICTED: NAC domain-containing protein 8 isofor... 58 7e-08 XP_014630861.1 PREDICTED: NAC domain-containing protein 8 isofor... 58 7e-08 KRG93195.1 hypothetical protein GLYMA_19G002900 [Glycine max] KR... 57 1e-07 XP_006603789.1 PREDICTED: NAC domain-containing protein 8-like [... 57 1e-07 XP_015971448.1 PREDICTED: NAC domain-containing protein 8 [Arach... 56 5e-07 KHN19686.1 NAC domain-containing protein 8 [Glycine soja] 55 6e-07 XP_016162321.1 PREDICTED: NAC domain-containing protein 8 [Arach... 55 7e-07 XP_006599082.1 PREDICTED: NAC domain-containing protein 8-like [... 55 7e-07 KHN27560.1 NAC domain-containing protein 8 [Glycine soja] 55 7e-07 XP_007150911.1 hypothetical protein PHAVU_004G004900g [Phaseolus... 54 3e-06 BAU00942.1 hypothetical protein VIGAN_11008400 [Vigna angularis ... 50 4e-06 >XP_019457348.1 PREDICTED: SUPPRESSOR OF GAMMA RESPONSE 1-like isoform X2 [Lupinus angustifolius] Length = 391 Score = 60.8 bits (146), Expect = 8e-09 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 N SYGISVLDTL+LDTPP+FDLSNL + SIL+W+DRL Sbjct: 350 NGEVSYGISVLDTLDLDTPPDFDLSNLAFCSEDSILDWMDRL 391 >XP_019457347.1 PREDICTED: SUPPRESSOR OF GAMMA RESPONSE 1-like isoform X1 [Lupinus angustifolius] OIW03013.1 hypothetical protein TanjilG_13650 [Lupinus angustifolius] Length = 392 Score = 60.8 bits (146), Expect = 8e-09 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 N SYGISVLDTL+LDTPP+FDLSNL + SIL+W+DRL Sbjct: 351 NGEVSYGISVLDTLDLDTPPDFDLSNLAFCSEDSILDWMDRL 392 >KYP44011.1 NAC domain-containing protein 8 [Cajanus cajan] Length = 412 Score = 60.8 bits (146), Expect = 8e-09 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 ND+ASYGIS+LDTLELD+PP+FDLSNL S L+W+D+L Sbjct: 371 NDHASYGISILDTLELDSPPDFDLSNLQFGSQDSTLQWIDKL 412 >KHN27473.1 NAC domain-containing protein 8 [Glycine soja] Length = 306 Score = 58.2 bits (139), Expect = 6e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -1 Query: 278 ENDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 162 +ND ASYG+SVLDTLE DTPP+FDLSNL S L+W+D Sbjct: 264 DNDYASYGVSVLDTLEFDTPPDFDLSNLQFGSQDSTLQWID 304 >XP_006579788.1 PREDICTED: NAC domain-containing protein 8 isoform X2 [Glycine max] KRH56531.1 hypothetical protein GLYMA_05G002700 [Glycine max] Length = 390 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -1 Query: 278 ENDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 162 +ND ASYG+SVLDTLE DTPP+FDLSNL S L+W+D Sbjct: 348 DNDYASYGVSVLDTLEFDTPPDFDLSNLQFGSQDSTLQWID 388 >XP_014630861.1 PREDICTED: NAC domain-containing protein 8 isoform X1 [Glycine max] Length = 391 Score = 58.2 bits (139), Expect = 7e-08 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -1 Query: 278 ENDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 162 +ND ASYG+SVLDTLE DTPP+FDLSNL S L+W+D Sbjct: 349 DNDYASYGVSVLDTLEFDTPPDFDLSNLQFGSQDSTLQWID 389 >KRG93195.1 hypothetical protein GLYMA_19G002900 [Glycine max] KRG93196.1 hypothetical protein GLYMA_19G002900 [Glycine max] Length = 363 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 162 ND SYG+SVLDTLELDTPP+FDLSNL S L+W+D Sbjct: 322 NDYGSYGVSVLDTLELDTPPDFDLSNLQFGSQDSTLQWID 361 >XP_006603789.1 PREDICTED: NAC domain-containing protein 8-like [Glycine max] KRG93194.1 hypothetical protein GLYMA_19G002900 [Glycine max] Length = 389 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 162 ND SYG+SVLDTLELDTPP+FDLSNL S L+W+D Sbjct: 348 NDYGSYGVSVLDTLELDTPPDFDLSNLQFGSQDSTLQWID 387 >XP_015971448.1 PREDICTED: NAC domain-containing protein 8 [Arachis duranensis] Length = 398 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 ND+ SYG SVLDTL+L TPP+FDLSNL SI +W+DRL Sbjct: 357 NDSLSYGTSVLDTLDLGTPPDFDLSNLNFYSQDSIFDWVDRL 398 >KHN19686.1 NAC domain-containing protein 8 [Glycine soja] Length = 389 Score = 55.5 bits (132), Expect = 6e-07 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLD 162 ND S+G+SVLDTLELDTPP+FDLSNL S L+W+D Sbjct: 348 NDYGSHGVSVLDTLELDTPPDFDLSNLQFGSQDSTLQWID 387 >XP_016162321.1 PREDICTED: NAC domain-containing protein 8 [Arachis ipaensis] Length = 398 Score = 55.5 bits (132), Expect = 7e-07 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 ND SYG SVLDTL+L TPP+FDLSNL SI +W+DRL Sbjct: 357 NDGLSYGTSVLDTLDLGTPPDFDLSNLNFYSQDSIFDWVDRL 398 >XP_006599082.1 PREDICTED: NAC domain-containing protein 8-like [Glycine max] XP_006599083.1 PREDICTED: NAC domain-containing protein 8-like [Glycine max] KRH07132.1 hypothetical protein GLYMA_16G069300 [Glycine max] KRH07133.1 hypothetical protein GLYMA_16G069300 [Glycine max] Length = 399 Score = 55.5 bits (132), Expect = 7e-07 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 3/43 (6%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNL---PQDSSILEWLDRL 156 NDN GIS+LDTLELDT P+FDLS+L QDSSIL+W+DRL Sbjct: 358 NDNEPCGISLLDTLELDT-PDFDLSSLYFCSQDSSILDWMDRL 399 >KHN27560.1 NAC domain-containing protein 8 [Glycine soja] Length = 416 Score = 55.5 bits (132), Expect = 7e-07 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 3/43 (6%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNL---PQDSSILEWLDRL 156 NDN GIS+LDTLELDT P+FDLS+L QDSSIL+W+DRL Sbjct: 375 NDNEPCGISLLDTLELDT-PDFDLSSLYFCSQDSSILDWMDRL 416 >XP_007150911.1 hypothetical protein PHAVU_004G004900g [Phaseolus vulgaris] ESW22905.1 hypothetical protein PHAVU_004G004900g [Phaseolus vulgaris] Length = 363 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/42 (59%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = -1 Query: 275 NDNASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 ND AS G+S+LDTLEL++PP+FDLSNL S L+W+D+L Sbjct: 322 NDYASSGVSLLDTLELESPPDFDLSNLQFGSQDSTLQWMDKL 363 >BAU00942.1 hypothetical protein VIGAN_11008400 [Vigna angularis var. angularis] Length = 72 Score = 50.1 bits (118), Expect = 4e-06 Identities = 26/45 (57%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = -1 Query: 281 GENDN-ASYGISVLDTLELDTPPEFDLSNLP--QDSSILEWLDRL 156 G ND+ AS G+SVLDTLE+DTP +FDL NL S L W+D+L Sbjct: 28 GNNDDYASSGVSVLDTLEIDTPSDFDLCNLQFGSQDSTLHWMDKL 72