BLASTX nr result
ID: Glycyrrhiza30_contig00014356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014356 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_003499398.1 bifunctional diguanylate cyclase/phosphodiesteras... 86 4e-18 WP_035224801.1 bifunctional diguanylate cyclase/phosphodiesteras... 81 2e-16 WP_052820401.1 diguanylate phosphodiesterase [Agrobacterium sp. ... 80 7e-16 WP_046801151.1 MULTISPECIES: bifunctional diguanylate cyclase/ph... 80 7e-16 WP_065116908.1 diguanylate phosphodiesterase [Agrobacterium rhiz... 77 8e-15 WP_076846029.1 bifunctional diguanylate cyclase/phosphodiesteras... 75 2e-14 SDF06052.1 diguanylate cyclase/phosphodiesterase [Rhizobium puse... 75 2e-14 WP_065663344.1 diguanylate phosphodiesterase [Agrobacterium tume... 75 2e-14 WP_065660282.1 diguanylate phosphodiesterase [Agrobacterium tume... 75 2e-14 WP_065688539.1 diguanylate phosphodiesterase [Agrobacterium tume... 75 2e-14 WP_065705654.1 diguanylate phosphodiesterase [Agrobacterium sp. ... 75 2e-14 WP_064264123.1 diguanylate phosphodiesterase [Rhizobium sp. GHKF... 75 2e-14 WP_060642602.1 bifunctional diguanylate cyclase/phosphodiesteras... 75 2e-14 WP_038495303.1 MULTISPECIES: bifunctional diguanylate cyclase/ph... 75 2e-14 WP_045533902.1 diguanylate phosphodiesterase [Rhizobium sp. LMB-1] 75 2e-14 WP_044458964.1 diguanylate phosphodiesterase [Rhizobium sp. UR51... 75 2e-14 WP_035200350.1 bifunctional diguanylate cyclase/phosphodiesteras... 75 2e-14 WP_034497992.1 diguanylate phosphodiesterase [Agrobacterium sp. ... 75 2e-14 WP_037092578.1 MULTISPECIES: diguanylate phosphodiesterase [Rhiz... 75 2e-14 WP_025594963.1 bifunctional diguanylate cyclase/phosphodiesteras... 75 2e-14 >WP_003499398.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium tumefaciens] EGP56167.1 GGDEF family protein [Agrobacterium tumefaciens F2] Length = 780 Score = 85.9 bits (211), Expect = 4e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAAS PNRKKYSV Sbjct: 740 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASAPNRKKYSV 780 >WP_035224801.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium tumefaciens] CDN94618.1 GGDEF family protein [Agrobacterium tumefaciens] Length = 780 Score = 81.3 bits (199), Expect = 2e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+GAASTP R+K+SV Sbjct: 740 DAQYRMVVDEGCAQAQGYLFGKPDVAPAGAASTPKRRKHSV 780 >WP_052820401.1 diguanylate phosphodiesterase [Agrobacterium sp. SUL3] KNY31884.1 diguanylate phosphodiesterase [Agrobacterium sp. SUL3] Length = 779 Score = 79.7 bits (195), Expect = 7e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+GAA T RKKYSV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAGAAGTTTRKKYSV 779 >WP_046801151.1 MULTISPECIES: bifunctional diguanylate cyclase/phosphodiesterase [Rhizobium/Agrobacterium group] KKX25459.1 diguanylate phosphodiesterase [Agrobacterium sp. LC34] KRA67520.1 diguanylate phosphodiesterase [Rhizobium sp. Root651] Length = 780 Score = 79.7 bits (195), Expect = 7e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+GAA T RKKYSV Sbjct: 740 DAQYRMVVDEGCAQAQGYLFGKPDVAPAGAAGTTTRKKYSV 780 >WP_065116908.1 diguanylate phosphodiesterase [Agrobacterium rhizogenes] OAM62808.1 diguanylate phosphodiesterase [Agrobacterium rhizogenes] AQS63585.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium rhizogenes] Length = 780 Score = 76.6 bits (187), Expect = 8e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKYSV Sbjct: 740 DAQYRMVVDEGCAQAQGYLFGKPDVAPAEAAGTTTRKKYSV 780 >WP_076846029.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium tumefaciens] OMP69533.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium tumefaciens] Length = 778 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 738 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 778 >SDF06052.1 diguanylate cyclase/phosphodiesterase [Rhizobium pusense] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKY+V Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAQAAGTTTRKKYTV 779 >WP_065663344.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] OCJ59782.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_065660282.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] OCJ45140.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] OCJ49109.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_065688539.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] OCJ34269.1 diguanylate phosphodiesterase [Agrobacterium tumefaciens] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_065705654.1 diguanylate phosphodiesterase [Agrobacterium sp. 13-2099-1-2] OCI91750.1 diguanylate phosphodiesterase [Agrobacterium sp. 13-2099-1-2] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_064264123.1 diguanylate phosphodiesterase [Rhizobium sp. GHKF11] OAI82201.1 diguanylate phosphodiesterase [Rhizobium sp. GHKF11] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKY+V Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAQAAGTTTRKKYTV 779 >WP_060642602.1 bifunctional diguanylate cyclase/phosphodiesterase [Rhizobium sp. Root491] KQY40959.1 diguanylate phosphodiesterase [Rhizobium sp. Root491] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_038495303.1 MULTISPECIES: bifunctional diguanylate cyclase/phosphodiesterase [Rhizobium/Agrobacterium group] AHK04370.1 diguanylate cyclase/phosphodiesterase (GGDEF &EAL domains) with PAS/PAC sensor(s) [Agrobacterium tumefaciens LBA4213 (Ach5)] AKC10112.1 diguanylate cyclase [Agrobacterium tumefaciens] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_045533902.1 diguanylate phosphodiesterase [Rhizobium sp. LMB-1] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKY+V Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAQAAGTTTRKKYTV 779 >WP_044458964.1 diguanylate phosphodiesterase [Rhizobium sp. UR51a] KIV67233.1 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) [Rhizobium sp. UR51a] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKY+V Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAQAAGTTTRKKYTV 779 >WP_035200350.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium tumefaciens] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779 >WP_034497992.1 diguanylate phosphodiesterase [Agrobacterium sp. 33MFTa1.1] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKY+V Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAQAAGTTTRKKYTV 779 >WP_037092578.1 MULTISPECIES: diguanylate phosphodiesterase [Rhizobium] KGE81262.1 diguanylate phosphodiesterase [Rhizobium sp. H41] ANV25833.1 diguanylate phosphodiesterase [Rhizobium sp. S41] OJH55174.1 diguanylate phosphodiesterase [Rhizobium pusense] OJH60620.1 diguanylate phosphodiesterase [Rhizobium pusense] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFGKPDVAP+ AA T RKKY+V Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGKPDVAPAQAAGTTTRKKYTV 779 >WP_025594963.1 bifunctional diguanylate cyclase/phosphodiesterase [Agrobacterium tumefaciens] Length = 779 Score = 75.5 bits (184), Expect = 2e-14 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +3 Query: 3 DAQYRMVVDEGCAQAQGYLFGKPDVAPSGAASTPNRKKYSV 125 DAQYRMVVDEGCAQAQGYLFG+PDVAP+ AAST RKK+SV Sbjct: 739 DAQYRMVVDEGCAQAQGYLFGRPDVAPAAAASTGKRKKHSV 779