BLASTX nr result
ID: Glycyrrhiza30_contig00014293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014293 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABV30744.1 kinase-like protein, partial [Prunus serrulata] 153 5e-46 XP_013448930.1 L-type lectin-domain receptor kinase IV.2-like pr... 160 1e-44 ABV30742.1 kinase-like protein, partial [Prunus serrulata] 149 2e-44 AAR08847.1 resistance protein candidate, partial [Vitis amurensis] 149 2e-44 XP_004492166.1 PREDICTED: L-type lectin-domain containing recept... 159 4e-44 XP_006387090.1 hypothetical protein POPTR_1896s002101g, partial ... 155 7e-44 XP_007140499.1 hypothetical protein PHAVU_008G117800g [Phaseolus... 157 3e-43 XP_014496468.1 PREDICTED: L-type lectin-domain containing recept... 157 3e-43 XP_010068032.1 PREDICTED: L-type lectin-domain containing recept... 151 3e-43 ONI03507.1 hypothetical protein PRUPE_6G261400 [Prunus persica] 154 4e-43 XP_002309078.1 hypothetical protein POPTR_0006s08970g [Populus t... 155 5e-43 XP_017415959.1 PREDICTED: L-type lectin-domain containing recept... 156 7e-43 XP_003529112.1 PREDICTED: L-type lectin-domain containing recept... 155 1e-42 KYP37520.1 Lectin-domain containing receptor kinase A4.3 [Cajanu... 155 1e-42 XP_006381205.1 hypothetical protein POPTR_0006s089001g, partial ... 155 1e-42 XP_016198358.1 PREDICTED: L-type lectin-domain containing recept... 155 2e-42 XP_015960581.1 PREDICTED: L-type lectin-domain containing recept... 155 2e-42 XP_011014312.1 PREDICTED: L-type lectin-domain containing recept... 155 2e-42 XP_011019818.1 PREDICTED: L-type lectin-domain containing recept... 155 2e-42 XP_011019817.1 PREDICTED: L-type lectin-domain containing recept... 155 2e-42 >ABV30744.1 kinase-like protein, partial [Prunus serrulata] Length = 165 Score = 153 bits (387), Expect = 5e-46 Identities = 71/83 (85%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGM+EFV+E++SIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 9 IAVKRVSHESRQGMKEFVAEIISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 68 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP VTLNW QRFR+IKGVAS Sbjct: 69 LYDQPAVTLNWRQRFRVIKGVAS 91 >XP_013448930.1 L-type lectin-domain receptor kinase IV.2-like protein [Medicago truncatula] AAR11299.1 lectin-like receptor kinase 7;2 [Medicago truncatula] KEH22957.1 L-type lectin-domain receptor kinase IV.2-like protein [Medicago truncatula] Length = 669 Score = 160 bits (406), Expect = 1e-44 Identities = 78/82 (95%), Positives = 79/82 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVKRVSHESRQGMREFVSE+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD Y Sbjct: 367 VAVKRVSHESRQGMREFVSEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDNY 426 Query: 71 LYNQPRVTLNWSQRFRIIKGVA 6 LYNQPRVTLNWSQRFRIIKGVA Sbjct: 427 LYNQPRVTLNWSQRFRIIKGVA 448 >ABV30742.1 kinase-like protein, partial [Prunus serrulata] Length = 165 Score = 149 bits (377), Expect = 2e-44 Identities = 70/83 (84%), Positives = 78/83 (93%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGM+EFV+E++SIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 9 IAVKRVSHESRQGMKEFVAEIISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 68 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP VTLNW QRF +IKGVAS Sbjct: 69 LYDQPVVTLNWRQRFIVIKGVAS 91 >AAR08847.1 resistance protein candidate, partial [Vitis amurensis] Length = 164 Score = 149 bits (376), Expect = 2e-44 Identities = 67/83 (80%), Positives = 80/83 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVK++SHESRQGM+EFV+E+VSIG LRHRN+V LLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 20 IAVKKISHESRQGMKEFVAEIVSIGRLRHRNIVSLLGYCRRKGELLLVYDYMPNGSLDKY 79 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP+V+LNWSQRFR++KGVAS Sbjct: 80 LYDQPKVSLNWSQRFRVLKGVAS 102 >XP_004492166.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Cicer arietinum] Length = 668 Score = 159 bits (403), Expect = 4e-44 Identities = 77/83 (92%), Positives = 80/83 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVKRVSHESRQGMREFVSE+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 366 VAVKRVSHESRQGMREFVSEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 425 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYNQP V+LNWSQRFRIIKGVAS Sbjct: 426 LYNQPNVSLNWSQRFRIIKGVAS 448 >XP_006387090.1 hypothetical protein POPTR_1896s002101g, partial [Populus trichocarpa] ERP46004.1 hypothetical protein POPTR_1896s002101g, partial [Populus trichocarpa] Length = 417 Score = 155 bits (391), Expect = 7e-44 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 295 IAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 354 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP V LNWSQRFR+IKGVAS Sbjct: 355 LYDQPTVALNWSQRFRVIKGVAS 377 >XP_007140499.1 hypothetical protein PHAVU_008G117800g [Phaseolus vulgaris] ESW12493.1 hypothetical protein PHAVU_008G117800g [Phaseolus vulgaris] Length = 668 Score = 157 bits (397), Expect = 3e-43 Identities = 75/83 (90%), Positives = 80/83 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVK+VSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 367 VAVKKVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 426 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYN+PRVTLNWSQRFRI KGVAS Sbjct: 427 LYNKPRVTLNWSQRFRITKGVAS 449 >XP_014496468.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Vigna radiata var. radiata] Length = 670 Score = 157 bits (397), Expect = 3e-43 Identities = 75/83 (90%), Positives = 80/83 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVK+VSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 369 VAVKKVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 428 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYN+PRVTLNWSQRFRI KGVAS Sbjct: 429 LYNKPRVTLNWSQRFRITKGVAS 451 >XP_010068032.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Eucalyptus grandis] Length = 329 Score = 151 bits (381), Expect = 3e-43 Identities = 68/83 (81%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKR+SHESRQGMREF++E++SIG LRHRN+V LLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 112 IAVKRISHESRQGMREFIAEIISIGRLRHRNIVSLLGYCRRKGELLLVYDYMPNGSLDKY 171 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 L+NQP+VTLNW QRFR+IKGVAS Sbjct: 172 LHNQPKVTLNWRQRFRVIKGVAS 194 >ONI03507.1 hypothetical protein PRUPE_6G261400 [Prunus persica] Length = 473 Score = 154 bits (389), Expect = 4e-43 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+EV+SIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 179 IAVKRVSHESRQGMREFVAEVISIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 238 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP VTLNW QRFR+IKGVAS Sbjct: 239 LYDQPVVTLNWRQRFRVIKGVAS 261 >XP_002309078.1 hypothetical protein POPTR_0006s08970g [Populus trichocarpa] EEE92601.1 hypothetical protein POPTR_0006s08970g [Populus trichocarpa] Length = 534 Score = 155 bits (391), Expect = 5e-43 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 231 IAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 290 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP V LNWSQRFR+IKGVAS Sbjct: 291 LYDQPTVALNWSQRFRVIKGVAS 313 >XP_017415959.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1 [Vigna angularis] KOM38048.1 hypothetical protein LR48_Vigan03g143000 [Vigna angularis] BAT84488.1 hypothetical protein VIGAN_04188300 [Vigna angularis var. angularis] Length = 670 Score = 156 bits (394), Expect = 7e-43 Identities = 74/83 (89%), Positives = 80/83 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVK+VSHESRQGMREFV+E+VSIG LRH+NLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 369 VAVKKVSHESRQGMREFVAEIVSIGRLRHKNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 428 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYN+PRVTLNWSQRFRI KGVAS Sbjct: 429 LYNKPRVTLNWSQRFRITKGVAS 451 >XP_003529112.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Glycine max] KHN40280.1 L-type lectin-domain containing receptor kinase IV.1 [Glycine soja] KRH49145.1 hypothetical protein GLYMA_07G135400 [Glycine max] Length = 667 Score = 155 bits (393), Expect = 1e-42 Identities = 74/83 (89%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVK+VSHESRQGMREFV+E+ SIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 366 VAVKKVSHESRQGMREFVAEIASIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 425 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYN+PRVTLNWSQRFRI KGVAS Sbjct: 426 LYNKPRVTLNWSQRFRITKGVAS 448 >KYP37520.1 Lectin-domain containing receptor kinase A4.3 [Cajanus cajan] Length = 668 Score = 155 bits (393), Expect = 1e-42 Identities = 74/83 (89%), Positives = 80/83 (96%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVK+VSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRR+ ELLLVYDYMPNGSLD+Y Sbjct: 366 VAVKKVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRREGELLLVYDYMPNGSLDKY 425 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYN+PRVTLNWSQRFRI KGVAS Sbjct: 426 LYNKPRVTLNWSQRFRITKGVAS 448 >XP_006381205.1 hypothetical protein POPTR_0006s089001g, partial [Populus trichocarpa] ERP59002.1 hypothetical protein POPTR_0006s089001g, partial [Populus trichocarpa] Length = 620 Score = 155 bits (391), Expect = 1e-42 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 356 IAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 415 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP V LNWSQRFR+IKGVAS Sbjct: 416 LYDQPTVALNWSQRFRVIKGVAS 438 >XP_016198358.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1 [Arachis ipaensis] Length = 688 Score = 155 bits (392), Expect = 2e-42 Identities = 75/83 (90%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMP GSLD+Y Sbjct: 380 VAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPKGSLDKY 439 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYNQPRVTLNW+QRF IIKGVAS Sbjct: 440 LYNQPRVTLNWNQRFIIIKGVAS 462 >XP_015960581.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Arachis duranensis] Length = 688 Score = 155 bits (392), Expect = 2e-42 Identities = 75/83 (90%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 VAVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMP GSLD+Y Sbjct: 380 VAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPKGSLDKY 439 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LYNQPRVTLNW+QRF IIKGVAS Sbjct: 440 LYNQPRVTLNWNQRFIIIKGVAS 462 >XP_011014312.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Populus euphratica] Length = 670 Score = 155 bits (391), Expect = 2e-42 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 372 IAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 431 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP V LNWSQRFR+IKGVAS Sbjct: 432 LYDQPTVALNWSQRFRVIKGVAS 454 >XP_011019818.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like isoform X2 [Populus euphratica] Length = 670 Score = 155 bits (391), Expect = 2e-42 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 372 IAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 431 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP V LNWSQRFR+IKGVAS Sbjct: 432 LYDQPTVALNWSQRFRVIKGVAS 454 >XP_011019817.1 PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like isoform X1 [Populus euphratica] Length = 675 Score = 155 bits (391), Expect = 2e-42 Identities = 73/83 (87%), Positives = 79/83 (95%) Frame = -3 Query: 251 VAVKRVSHESRQGMREFVSEVVSIGHLRHRNLVPLLGYCRRKRELLLVYDYMPNGSLDRY 72 +AVKRVSHESRQGMREFV+E+VSIG LRHRNLVPLLGYCRRK ELLLVYDYMPNGSLD+Y Sbjct: 372 IAVKRVSHESRQGMREFVAEIVSIGRLRHRNLVPLLGYCRRKGELLLVYDYMPNGSLDKY 431 Query: 71 LYNQPRVTLNWSQRFRIIKGVAS 3 LY+QP V LNWSQRFR+IKGVAS Sbjct: 432 LYDQPTVALNWSQRFRVIKGVAS 454