BLASTX nr result
ID: Glycyrrhiza30_contig00014163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014163 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU24351.1 unknown [Glycine max] 85 2e-17 KHN47162.1 Ribosome biogenesis regulatory protein like [Glycine ... 86 3e-17 XP_003549765.1 PREDICTED: ribosome biogenesis regulatory protein... 86 3e-17 XP_003542685.1 PREDICTED: ribosome biogenesis regulatory protein... 86 3e-17 XP_017409803.1 PREDICTED: ribosome biogenesis regulatory protein... 86 3e-17 XP_007154994.1 hypothetical protein PHAVU_003G163900g [Phaseolus... 84 1e-16 XP_017422853.1 PREDICTED: ribosome biogenesis regulatory protein... 83 2e-16 XP_014499127.1 PREDICTED: ribosome biogenesis regulatory protein... 83 2e-16 KOM33044.1 hypothetical protein LR48_Vigan01g260000 [Vigna angul... 83 3e-16 XP_007139018.1 hypothetical protein PHAVU_009G258100g [Phaseolus... 82 6e-16 XP_004485584.1 PREDICTED: ribosome biogenesis regulatory protein... 82 8e-16 KYP51112.1 hypothetical protein KK1_027029 [Cajanus cajan] 82 8e-16 XP_002264648.1 PREDICTED: ribosome biogenesis regulatory protein... 80 4e-15 XP_014507406.1 PREDICTED: ribosome biogenesis regulatory protein... 80 4e-15 XP_019452345.1 PREDICTED: ribosome biogenesis regulatory protein... 78 2e-14 XP_019463261.1 PREDICTED: ribosome biogenesis regulatory protein... 78 2e-14 XP_018839554.1 PREDICTED: ribosome biogenesis regulatory protein... 78 2e-14 XP_016166896.1 PREDICTED: ribosome biogenesis regulatory protein... 76 7e-14 XP_015933076.1 PREDICTED: ribosome biogenesis regulatory protein... 76 7e-14 GAV68336.1 RRS1 domain-containing protein [Cephalotus follicularis] 76 8e-14 >ACU24351.1 unknown [Glycine max] Length = 286 Score = 85.1 bits (209), Expect = 2e-17 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLEREQTEKILNKI+SKNSH+ILNV+KAVTMHNV Sbjct: 202 LPVVEGTGIGSLEREQTEKILNKIVSKNSHNILNVEKAVTMHNV 245 >KHN47162.1 Ribosome biogenesis regulatory protein like [Glycine soja] Length = 330 Score = 85.5 bits (210), Expect = 3e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLEREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 246 LPVVEGTGIGSLEREQTEKILNKIISKNSHNILNVEKAVTMHNV 289 >XP_003549765.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Glycine max] KHN15099.1 Ribosome biogenesis regulatory protein like [Glycine soja] KRH03707.1 hypothetical protein GLYMA_17G115500 [Glycine max] Length = 331 Score = 85.5 bits (210), Expect = 3e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLEREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 246 LPVVEGTGIGSLEREQTEKILNKIISKNSHNILNVEKAVTMHNV 289 >XP_003542685.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Glycine max] KRH20282.1 hypothetical protein GLYMA_13G167900 [Glycine max] Length = 332 Score = 85.5 bits (210), Expect = 3e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLEREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 248 LPVVEGTGIGSLEREQTEKILNKIISKNSHNILNVEKAVTMHNV 291 >XP_017409803.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Vigna angularis] KOM29128.1 hypothetical protein LR48_Vigan635s005300 [Vigna angularis] BAT80365.1 hypothetical protein VIGAN_02337000 [Vigna angularis var. angularis] Length = 340 Score = 85.5 bits (210), Expect = 3e-17 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLEREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 251 LPVVEGTGIGSLEREQTEKILNKIISKNSHNILNVEKAVTMHNV 294 >XP_007154994.1 hypothetical protein PHAVU_003G163900g [Phaseolus vulgaris] ESW26988.1 hypothetical protein PHAVU_003G163900g [Phaseolus vulgaris] Length = 333 Score = 84.0 bits (206), Expect = 1e-16 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEG+GIGSLEREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 250 LPVVEGSGIGSLEREQTEKILNKIISKNSHNILNVEKAVTMHNV 293 >XP_017422853.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Vigna angularis] BAT76364.1 hypothetical protein VIGAN_01435200 [Vigna angularis var. angularis] Length = 333 Score = 83.2 bits (204), Expect = 2e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGS EREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 250 LPVVEGTGIGSQEREQTEKILNKIISKNSHNILNVEKAVTMHNV 293 >XP_014499127.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Vigna radiata var. radiata] Length = 340 Score = 83.2 bits (204), Expect = 2e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGS EREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 251 LPVVEGTGIGSQEREQTEKILNKIISKNSHNILNVEKAVTMHNV 294 >KOM33044.1 hypothetical protein LR48_Vigan01g260000 [Vigna angularis] Length = 358 Score = 83.2 bits (204), Expect = 3e-16 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGS EREQTEKILNKIISKNSH+ILNV+KAVTMHNV Sbjct: 275 LPVVEGTGIGSQEREQTEKILNKIISKNSHNILNVEKAVTMHNV 318 >XP_007139018.1 hypothetical protein PHAVU_009G258100g [Phaseolus vulgaris] ESW11012.1 hypothetical protein PHAVU_009G258100g [Phaseolus vulgaris] Length = 334 Score = 82.0 bits (201), Expect = 6e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGS EREQTEKILNKI+SKNSH+ILNV+KAVTMHNV Sbjct: 252 LPVVEGTGIGSQEREQTEKILNKIMSKNSHNILNVEKAVTMHNV 295 >XP_004485584.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Cicer arietinum] Length = 331 Score = 81.6 bits (200), Expect = 8e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGS+EREQTEKILNKI++KNSHDILNV KAVT+HNV Sbjct: 248 LPVVEGTGIGSMEREQTEKILNKIMAKNSHDILNVTKAVTVHNV 291 >KYP51112.1 hypothetical protein KK1_027029 [Cajanus cajan] Length = 337 Score = 81.6 bits (200), Expect = 8e-16 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLEREQTEKILNKI+SKNSHDILNV KAVT+H V Sbjct: 246 LPVVEGTGIGSLEREQTEKILNKIMSKNSHDILNVQKAVTVHTV 289 >XP_002264648.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Vitis vinifera] CBI38699.3 unnamed protein product, partial [Vitis vinifera] Length = 327 Score = 79.7 bits (195), Expect = 4e-15 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGSLE++QTEKILNK+ISKNSH+ILNVDKA+ M+NV Sbjct: 242 LPVVEGTGIGSLEKQQTEKILNKLISKNSHEILNVDKAINMYNV 285 >XP_014507406.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Vigna radiata var. radiata] Length = 333 Score = 79.7 bits (195), Expect = 4e-15 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEGTGIGS EREQTEKILNKIIS+NSH+ILNV+KAVTMH V Sbjct: 250 LPVVEGTGIGSQEREQTEKILNKIISRNSHNILNVEKAVTMHTV 293 >XP_019452345.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Lupinus angustifolius] OIW18574.1 hypothetical protein TanjilG_13326 [Lupinus angustifolius] Length = 336 Score = 78.2 bits (191), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -3 Query: 397 LPVV-EGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVV +GTGIGSLE+EQTEK+LNKI+SKNSHDILNV KAVTMHNV Sbjct: 248 LPVVGQGTGIGSLEKEQTEKVLNKIMSKNSHDILNVSKAVTMHNV 292 >XP_019463261.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Lupinus angustifolius] OIV99918.1 hypothetical protein TanjilG_26256 [Lupinus angustifolius] Length = 339 Score = 78.2 bits (191), Expect = 2e-14 Identities = 39/45 (86%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -3 Query: 397 LPVV-EGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVV +GTGIGSLE+EQTEK+LNKI+SKNSHDILNV KAVTMHNV Sbjct: 251 LPVVGQGTGIGSLEKEQTEKVLNKIMSKNSHDILNVSKAVTMHNV 295 >XP_018839554.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Juglans regia] Length = 340 Score = 78.2 bits (191), Expect = 2e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEG GIGS E+EQTEK+LNK+ISKNSH+ILNVDKAVTM+NV Sbjct: 242 LPVVEGKGIGSQEKEQTEKVLNKLISKNSHEILNVDKAVTMYNV 285 >XP_016166896.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Arachis ipaensis] Length = 331 Score = 76.3 bits (186), Expect = 7e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEG GIGS E+EQTEKILNKI+SK+SHDILNVDKAV+MH V Sbjct: 248 LPVVEGKGIGSQEKEQTEKILNKIMSKHSHDILNVDKAVSMHTV 291 >XP_015933076.1 PREDICTED: ribosome biogenesis regulatory protein homolog [Arachis duranensis] Length = 331 Score = 76.3 bits (186), Expect = 7e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEG GIGS E+EQTEKILNKI+SK+SHDILNVDKAV+MH V Sbjct: 248 LPVVEGKGIGSQEKEQTEKILNKIMSKHSHDILNVDKAVSMHTV 291 >GAV68336.1 RRS1 domain-containing protein [Cephalotus follicularis] Length = 332 Score = 76.3 bits (186), Expect = 8e-14 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 397 LPVVEGTGIGSLEREQTEKILNKIISKNSHDILNVDKAVTMHNV 266 LPVVEG+GIGSLE+EQTEK+LNK+ISKNS +ILNVDKAV M+NV Sbjct: 241 LPVVEGSGIGSLEKEQTEKVLNKLISKNSREILNVDKAVNMYNV 284