BLASTX nr result
ID: Glycyrrhiza30_contig00014102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014102 (396 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU43665.1 hypothetical protein TSUD_302280, partial [Trifolium ... 79 3e-16 >GAU43665.1 hypothetical protein TSUD_302280, partial [Trifolium subterraneum] Length = 126 Score = 78.6 bits (192), Expect = 3e-16 Identities = 40/62 (64%), Positives = 42/62 (67%), Gaps = 14/62 (22%) Frame = -1 Query: 396 EVQKGLEVDLWSDLCLGHGL----------DPGPDQHRQSNLPGQDHDHAQ----DLHAR 259 EV+KGLEVDLWSDLCLGH L DP PDQHRQS+LP QDHDH Q D HAR Sbjct: 17 EVRKGLEVDLWSDLCLGHDLFPGLGLGPGPDPDPDQHRQSSLPSQDHDHVQHLLHDHHAR 76 Query: 258 CC 253 C Sbjct: 77 FC 78