BLASTX nr result
ID: Glycyrrhiza30_contig00014046
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00014046 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48474.1 hypothetical protein TSUD_405670 [Trifolium subterran... 64 6e-10 XP_004497514.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplas... 63 1e-09 KHN48247.1 Ribonucleoprotein, chloroplastic [Glycine soja] 56 4e-07 NP_001240946.1 uncharacterized protein LOC100812934 [Glycine max... 56 4e-07 XP_003535181.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplas... 55 5e-07 >GAU48474.1 hypothetical protein TSUD_405670 [Trifolium subterraneum] Length = 278 Score = 63.5 bits (153), Expect = 6e-10 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +3 Query: 156 MSTTAASLALPTLQTRKPLCSSPQCLSS--RFSLNPNFKPFSI 278 MST+A SLALP+L T+ PLCSSPQC SS SLNPNFKPFSI Sbjct: 1 MSTSATSLALPSLFTKNPLCSSPQCFSSLPSLSLNPNFKPFSI 43 >XP_004497514.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Cicer arietinum] Length = 284 Score = 62.8 bits (151), Expect = 1e-09 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +3 Query: 156 MSTTAASLALPTLQTRKPLCSSPQCLSSR--FSLNPNFKPFSI 278 MS++AASLALPTL+T++PLC SPQC SS FS+NPNFKPFSI Sbjct: 1 MSSSAASLALPTLRTKQPLC-SPQCFSSHPSFSINPNFKPFSI 42 >KHN48247.1 Ribonucleoprotein, chloroplastic [Glycine soja] Length = 279 Score = 55.8 bits (133), Expect = 4e-07 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 156 MSTTAASLALPTL--QTRKPLCSSPQCLSSRFSLNPNFKPFSI 278 MST+AASLALPTL +TR+PLCS PQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLCS-PQCFSSSLSLTPNSKPISI 42 >NP_001240946.1 uncharacterized protein LOC100812934 [Glycine max] ACU20155.1 unknown [Glycine max] KRH19946.1 hypothetical protein GLYMA_13G145200 [Glycine max] Length = 279 Score = 55.8 bits (133), Expect = 4e-07 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 156 MSTTAASLALPTL--QTRKPLCSSPQCLSSRFSLNPNFKPFSI 278 MST+AASLALPTL +TR+PLCS PQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLCS-PQCFSSSLSLTPNSKPISI 42 >XP_003535181.1 PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Glycine max] KRH32548.1 hypothetical protein GLYMA_10G058500 [Glycine max] Length = 275 Score = 55.5 bits (132), Expect = 5e-07 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 156 MSTTAASLALPTL--QTRKPLCSSPQCLSSRFSLNPNFKPFSI 278 MST+AASLALPTL +TR+PLCS PQC SS SL PN KP SI Sbjct: 1 MSTSAASLALPTLTLRTRQPLCS-PQCFSSSLSLTPNNKPISI 42