BLASTX nr result
ID: Glycyrrhiza30_contig00013692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00013692 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAU94133.1 hypothetical protein MPPM_5528 (plasmid) [Methylobact... 71 6e-14 WP_043768335.1 hypothetical protein [Methylobacterium extorquens] 70 1e-13 OHV18069.1 hypothetical protein BK022_01785 [Methylobacterium ex... 69 4e-13 OHV14619.1 hypothetical protein BK022_25225 [Methylobacterium ex... 69 4e-13 ACS44153.1 conserved hypothetical protein (plasmid) [Methylobact... 70 5e-13 WP_076641508.1 hypothetical protein [Methylobacterium extorquens... 65 7e-12 WP_007558558.1 hypothetical protein [Methylobacterium sp. GXF4] ... 65 1e-11 WP_017482494.1 hypothetical protein [Methylobacterium sp. MB200] 64 2e-11 WP_050736109.1 hypothetical protein [Methylobacterium sp. ARG-1]... 63 6e-11 WP_012779277.1 hypothetical protein [Methylobacterium extorquens... 63 8e-11 WP_076729723.1 hypothetical protein [Methylobacterium radiotoler... 61 3e-10 AGO88402.1 protein of unassigned function (plasmid) [Methylobact... 60 9e-10 WP_012457147.1 hypothetical protein [Methylobacterium populi] AC... 57 2e-08 WP_075382274.1 hypothetical protein [Methylobacterium phyllospha... 54 3e-07 WP_056116220.1 hypothetical protein [Methylobacterium sp. Leaf12... 53 6e-07 WP_036262893.1 hypothetical protein [Methylocapsa aurea] 52 2e-06 WP_026605562.1 hypothetical protein [Methylocapsa acidiphila] 52 2e-06 KOX56767.1 hypothetical protein ADL14_20120 [Asanoa ferruginea] 50 3e-06 WP_053621745.1 hypothetical protein [Asanoa ferruginea] 50 4e-06 >BAU94133.1 hypothetical protein MPPM_5528 (plasmid) [Methylobacterium populi] Length = 150 Score = 70.9 bits (172), Expect = 6e-14 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF*SAD 105 DR EHLRQRWFTYRHRKALGDLFLGPYPFR+ +D Sbjct: 116 DRTEHLRQRWFTYRHRKALGDLFLGPYPFRYMRSD 150 >WP_043768335.1 hypothetical protein [Methylobacterium extorquens] Length = 146 Score = 70.1 bits (170), Expect = 1e-13 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EHLRQRWFTYRHRKALGDLFLGPYPFR+ Sbjct: 116 DRTEHLRQRWFTYRHRKALGDLFLGPYPFRY 146 >OHV18069.1 hypothetical protein BK022_01785 [Methylobacterium extorquens] Length = 150 Score = 68.9 bits (167), Expect = 4e-13 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DR EHLRQRWFTYRHRKALGDLFLGPYPFR Sbjct: 116 DRTEHLRQRWFTYRHRKALGDLFLGPYPFR 145 >OHV14619.1 hypothetical protein BK022_25225 [Methylobacterium extorquens] Length = 150 Score = 68.9 bits (167), Expect = 4e-13 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EHLRQRWFTYRHR+ALGDLFLGPYPFR+ Sbjct: 116 DRTEHLRQRWFTYRHRRALGDLFLGPYPFRY 146 >ACS44153.1 conserved hypothetical protein (plasmid) [Methylobacterium extorquens AM1] Length = 222 Score = 70.1 bits (170), Expect = 5e-13 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EHLRQRWFTYRHRKALGDLFLGPYPFR+ Sbjct: 192 DRTEHLRQRWFTYRHRKALGDLFLGPYPFRY 222 >WP_076641508.1 hypothetical protein [Methylobacterium extorquens] APX84413.1 hypothetical protein BV511_06570 [Methylobacterium extorquens] Length = 145 Score = 65.5 bits (158), Expect = 7e-12 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DR EHLRQRWFTYRHRKALGDLFLGPYP R Sbjct: 116 DRPEHLRQRWFTYRHRKALGDLFLGPYPTR 145 >WP_007558558.1 hypothetical protein [Methylobacterium sp. GXF4] EIZ86844.1 hypothetical protein WYO_0493 [Methylobacterium sp. GXF4] Length = 146 Score = 65.1 bits (157), Expect = 1e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DRAEH RQRWFTYR RKALGDLFLGPYPFR+ Sbjct: 116 DRAEHQRQRWFTYRVRKALGDLFLGPYPFRY 146 >WP_017482494.1 hypothetical protein [Methylobacterium sp. MB200] Length = 146 Score = 64.3 bits (155), Expect = 2e-11 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DRAEHLRQRWFTYR R+A GDLFLGPYPFR+ Sbjct: 116 DRAEHLRQRWFTYRARRASGDLFLGPYPFRY 146 >WP_050736109.1 hypothetical protein [Methylobacterium sp. ARG-1] KNY19579.1 hypothetical protein AKJ13_27155 [Methylobacterium sp. ARG-1] Length = 146 Score = 63.2 bits (152), Expect = 6e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EH RQRWFTYR RKALGDLFLGPYPFR+ Sbjct: 116 DREEHQRQRWFTYRVRKALGDLFLGPYPFRY 146 >WP_012779277.1 hypothetical protein [Methylobacterium extorquens] CAX17137.1 conserved hypothetical protein (plasmid) [Methylobacterium extorquens DM4] BAU94119.1 hypothetical protein MPPM_5514 (plasmid) [Methylobacterium populi] Length = 146 Score = 62.8 bits (151), Expect = 8e-11 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EHLRQRWFTYR R+A GDLFLGPYPFR+ Sbjct: 116 DRTEHLRQRWFTYRARRASGDLFLGPYPFRY 146 >WP_076729723.1 hypothetical protein [Methylobacterium radiotolerans] ONF47364.1 hypothetical protein RSM1_19950 [Methylobacterium radiotolerans] Length = 146 Score = 61.2 bits (147), Expect = 3e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EHLRQRW TYR RKA+GDLFLGPYPFR+ Sbjct: 116 DRDEHLRQRWVTYRVRKAVGDLFLGPYPFRY 146 >AGO88402.1 protein of unassigned function (plasmid) [Methylobacterium oryzae CBMB20] Length = 146 Score = 60.1 bits (144), Expect = 9e-10 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFRF 117 DR EH RQRW TYR RKALGDLFLGPYPFR+ Sbjct: 116 DRDEHRRQRWVTYRVRKALGDLFLGPYPFRY 146 >WP_012457147.1 hypothetical protein [Methylobacterium populi] ACB83526.1 conserved hypothetical protein (plasmid) [Methylobacterium populi BJ001] Length = 145 Score = 56.6 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DRAEHLRQR TYR RKALGDLFLGPYP R Sbjct: 116 DRAEHLRQRQLTYRLRKALGDLFLGPYPLR 145 >WP_075382274.1 hypothetical protein [Methylobacterium phyllosphaerae] SFH68556.1 hypothetical protein SAMN05192567_14414 [Methylobacterium phyllosphaerae] APT35134.1 hypothetical protein MCBMB27_05843 (plasmid) [Methylobacterium phyllosphaerae] Length = 150 Score = 53.5 bits (127), Expect = 3e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DR EHLRQRW TYR RKA GDLFLGPY R Sbjct: 116 DREEHLRQRWLTYRLRKARGDLFLGPYTAR 145 >WP_056116220.1 hypothetical protein [Methylobacterium sp. Leaf122] KQQ17617.1 hypothetical protein ASF56_23130 [Methylobacterium sp. Leaf122] Length = 145 Score = 52.8 bits (125), Expect = 6e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DR EHLRQR TYR RKALGDLFLGPYP R Sbjct: 116 DRPEHLRQRRLTYRLRKALGDLFLGPYPPR 145 >WP_036262893.1 hypothetical protein [Methylocapsa aurea] Length = 143 Score = 51.6 bits (122), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPF 123 DR EH RQRW T R RKALGDLFLGPY F Sbjct: 114 DRDEHRRQRWLTLRMRKALGDLFLGPYKF 142 >WP_026605562.1 hypothetical protein [Methylocapsa acidiphila] Length = 143 Score = 51.6 bits (122), Expect = 2e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPF 123 DR EH RQRW T R RKALGDLFLGPY F Sbjct: 114 DRDEHRRQRWLTLRMRKALGDLFLGPYKF 142 >KOX56767.1 hypothetical protein ADL14_20120 [Asanoa ferruginea] Length = 128 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DR EHLR+R TY R+ALGDLFLGPYP R Sbjct: 99 DRPEHLRRRQLTYLRRRALGDLFLGPYPLR 128 >WP_053621745.1 hypothetical protein [Asanoa ferruginea] Length = 143 Score = 50.4 bits (119), Expect = 4e-06 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = -2 Query: 209 DRAEHLRQRWFTYRHRKALGDLFLGPYPFR 120 DR EHLR+R TY R+ALGDLFLGPYP R Sbjct: 114 DRPEHLRRRQLTYLRRRALGDLFLGPYPLR 143