BLASTX nr result
ID: Glycyrrhiza30_contig00012674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00012674 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004492701.1 PREDICTED: NAD(P)H-quinone oxidoreductase subunit... 56 2e-07 GAV65767.1 hypothetical protein CFOL_v3_09281 [Cephalotus follic... 54 1e-06 KYP64403.1 hypothetical protein KK1_018999 [Cajanus cajan] 54 2e-06 XP_007139909.1 hypothetical protein PHAVU_008G068900g [Phaseolus... 53 4e-06 >XP_004492701.1 PREDICTED: NAD(P)H-quinone oxidoreductase subunit S, chloroplastic-like [Cicer arietinum] Length = 148 Score = 55.8 bits (133), Expect = 2e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -3 Query: 364 MMGLTGGFPGGEKGLIKFIEENPTPQNRN*ILIF*PFHQSHLEE 233 MMGLTGGFPGGEKGLIKFIEENP P+N + +QS LEE Sbjct: 102 MMGLTGGFPGGEKGLIKFIEENP-PRNSSQPFTIEENNQSFLEE 144 >GAV65767.1 hypothetical protein CFOL_v3_09281 [Cephalotus follicularis] Length = 150 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 364 MMGLTGGFPGGEKGLIKFIEENPTPQ 287 +MGLTGGFPGGEKGLIKFIEENP P+ Sbjct: 110 LMGLTGGFPGGEKGLIKFIEENPPPK 135 >KYP64403.1 hypothetical protein KK1_018999 [Cajanus cajan] Length = 150 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -3 Query: 364 MMGLTGGFPGGEKGLIKFIEENPTPQ 287 MMGLTGGFPGGEKGLIKFIE+NP P+ Sbjct: 111 MMGLTGGFPGGEKGLIKFIEKNPPPK 136 >XP_007139909.1 hypothetical protein PHAVU_008G068900g [Phaseolus vulgaris] XP_007139910.1 hypothetical protein PHAVU_008G068900g [Phaseolus vulgaris] ESW11903.1 hypothetical protein PHAVU_008G068900g [Phaseolus vulgaris] ESW11904.1 hypothetical protein PHAVU_008G068900g [Phaseolus vulgaris] Length = 154 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 364 MMGLTGGFPGGEKGLIKFIEENPTPQNRN 278 MMGLTGGFPGGEKGL KFIE+NP P++ N Sbjct: 120 MMGLTGGFPGGEKGLKKFIEKNPPPKSDN 148