BLASTX nr result
ID: Glycyrrhiza30_contig00012547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00012547 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABH02914.1 MYB transcription factor MYB78, partial [Glycine max] 59 1e-08 KHN02315.1 Transcription factor RAX3 [Glycine soja] 59 2e-08 XP_006604580.1 PREDICTED: transcription factor RAX2 [Glycine max... 59 2e-08 XP_007162775.1 hypothetical protein PHAVU_001G179400g [Phaseolus... 57 1e-07 >ABH02914.1 MYB transcription factor MYB78, partial [Glycine max] Length = 228 Score = 59.3 bits (142), Expect = 1e-08 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 5/50 (10%) Frame = +1 Query: 121 ANPIFQAQESFNIGPTQKCQFKD-SNISNFVLGGE----AISCCSSDGSC 255 AN FQAQESF I PTQKCQFKD SN S F+ GGE A SC SSDGSC Sbjct: 179 ANSFFQAQESF-IDPTQKCQFKDSSNNSMFLFGGEATATATSCSSSDGSC 227 >KHN02315.1 Transcription factor RAX3 [Glycine soja] Length = 330 Score = 59.3 bits (142), Expect = 2e-08 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 5/50 (10%) Frame = +1 Query: 121 ANPIFQAQESFNIGPTQKCQFKD-SNISNFVLGGE----AISCCSSDGSC 255 AN FQAQESF I PTQKCQFKD SN S F+ GGE A SC SSDGSC Sbjct: 179 ANSFFQAQESF-IDPTQKCQFKDSSNNSMFLFGGEATATATSCSSSDGSC 227 >XP_006604580.1 PREDICTED: transcription factor RAX2 [Glycine max] KRG96025.1 hypothetical protein GLYMA_19G184500 [Glycine max] Length = 330 Score = 59.3 bits (142), Expect = 2e-08 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 5/50 (10%) Frame = +1 Query: 121 ANPIFQAQESFNIGPTQKCQFKD-SNISNFVLGGE----AISCCSSDGSC 255 AN FQAQESF I PTQKCQFKD SN S F+ GGE A SC SSDGSC Sbjct: 179 ANSFFQAQESF-IDPTQKCQFKDSSNNSMFLFGGEATATATSCSSSDGSC 227 >XP_007162775.1 hypothetical protein PHAVU_001G179400g [Phaseolus vulgaris] ESW34769.1 hypothetical protein PHAVU_001G179400g [Phaseolus vulgaris] Length = 331 Score = 57.0 bits (136), Expect = 1e-07 Identities = 34/48 (70%), Positives = 35/48 (72%), Gaps = 3/48 (6%) Frame = +1 Query: 121 ANPIFQAQESFNIGPTQKCQFKD-SNISNFVLGGE--AISCCSSDGSC 255 A+ FQAQESF I PTQKCQFKD SN S FV GGE A SC SSD SC Sbjct: 185 ADSFFQAQESF-IDPTQKCQFKDSSNNSMFVFGGEAAATSCSSSDASC 231