BLASTX nr result
ID: Glycyrrhiza30_contig00010734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00010734 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP73879.1 B3 domain-containing protein At5g06250 family [Cajanu... 56 2e-07 XP_004513583.1 PREDICTED: B3 domain-containing protein At2g36080... 54 2e-06 KHN23091.1 hypothetical protein glysoja_046625 [Glycine soja] 51 8e-06 >KYP73879.1 B3 domain-containing protein At5g06250 family [Cajanus cajan] Length = 309 Score = 56.2 bits (134), Expect = 2e-07 Identities = 30/50 (60%), Positives = 33/50 (66%), Gaps = 2/50 (4%) Frame = -1 Query: 250 CSHNSDNNMPSTQGTDT--HHFYHYHQXXXXXXXXXXXXXHMVRHQPYYY 107 CS+NS NNMP+TQGTDT HHFYH+H HMVRHQPYYY Sbjct: 264 CSYNS-NNMPTTQGTDTHHHHFYHHHH---HHQPSSNPSPHMVRHQPYYY 309 >XP_004513583.1 PREDICTED: B3 domain-containing protein At2g36080-like [Cicer arietinum] Length = 322 Score = 53.5 bits (127), Expect = 2e-06 Identities = 28/49 (57%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = -1 Query: 250 CSHNSDNNMPSTQGTD-THHFYHYHQXXXXXXXXXXXXXHMVRHQPYYY 107 CS NNMPSTQGTD T H YHYHQ H+VRHQPYYY Sbjct: 275 CSSYDSNNMPSTQGTDHTQHLYHYHQ-PSSHNSNSNSHSHVVRHQPYYY 322 >KHN23091.1 hypothetical protein glysoja_046625 [Glycine soja] Length = 208 Score = 51.2 bits (121), Expect = 8e-06 Identities = 21/48 (43%), Positives = 29/48 (60%) Frame = -1 Query: 250 CSHNSDNNMPSTQGTDTHHFYHYHQXXXXXXXXXXXXXHMVRHQPYYY 107 CS+N++N +PSTQGTD H +++Q M+RHQPYYY Sbjct: 161 CSYNTNNILPSTQGTDIHSHLNFYQQQQTSNSKPPPHHMMIRHQPYYY 208