BLASTX nr result
ID: Glycyrrhiza30_contig00010386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00010386 (203 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACB82609.1 hypothetical protein Mpop_4511 [Methylobacterium popu... 54 1e-08 ACS42050.1 hypothetical protein MexAM1_META1p4419 [Methylobacter... 51 2e-07 >ACB82609.1 hypothetical protein Mpop_4511 [Methylobacterium populi BJ001] Length = 37 Score = 54.3 bits (129), Expect = 1e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 106 MRGILRQILVVFLLPKAIAWVRRRYGGGRHA 198 MR ILRQILVVFLLPKAI+++RRRYGGGR A Sbjct: 1 MRSILRQILVVFLLPKAISYLRRRYGGGRAA 31 >ACS42050.1 hypothetical protein MexAM1_META1p4419 [Methylobacterium extorquens AM1] CAX26638.1 hypothetical protein METDI5023 [Methylobacterium extorquens DM4] EHP94153.1 hypothetical protein MetexDRAFT_0992 [Methylobacterium extorquens DSM 13060] AMB47243.1 hypothetical protein Y590_20065 [Methylobacterium sp. AMS5] Length = 37 Score = 51.2 bits (121), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 106 MRGILRQILVVFLLPKAIAWVRRRYGGGRHA 198 MR ILRQI+VVFLLPKAI ++RRR+GGGR A Sbjct: 1 MRSILRQIVVVFLLPKAIGYLRRRFGGGRAA 31