BLASTX nr result
ID: Glycyrrhiza30_contig00010042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00010042 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAQ03962.1 hypothetical protein ALT_1283 [Aspergillus lentulus] 55 6e-07 GAQ03960.1 hypothetical protein ALT_1281 [Aspergillus lentulus] 55 6e-07 KNE89549.1 hypothetical protein PSTG_16994 [Puccinia striiformis... 41 3e-06 XP_013955648.1 hypothetical protein TRIVIDRAFT_180510, partial [... 49 8e-06 >GAQ03962.1 hypothetical protein ALT_1283 [Aspergillus lentulus] Length = 510 Score = 55.1 bits (131), Expect = 6e-07 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = +2 Query: 80 VVCKGFNPAHCKIARRQLVPRTFTETPLPTS*DSGPKAYSYPTTMCGKKSPRSGMD 247 VVC+GF PA IA RQ P + + GP+AYSYPTT CG SPRSG D Sbjct: 304 VVCRGFIPARGDIAIRQPAPGVSPGSRRQPAEVHGPEAYSYPTTTCGATSPRSGTD 359 >GAQ03960.1 hypothetical protein ALT_1281 [Aspergillus lentulus] Length = 643 Score = 55.1 bits (131), Expect = 6e-07 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = +2 Query: 80 VVCKGFNPAHCKIARRQLVPRTFTETPLPTS*DSGPKAYSYPTTMCGKKSPRSGMD 247 VVC+GF PA IA RQ P + + GP+AYSYPTT CG SPRSG D Sbjct: 552 VVCRGFIPARGDIAIRQPAPGVSPGSRRQPAEVHGPEAYSYPTTTCGATSPRSGTD 607 >KNE89549.1 hypothetical protein PSTG_16994 [Puccinia striiformis f. sp. tritici PST-78] Length = 125 Score = 41.2 bits (95), Expect(2) = 3e-06 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = +3 Query: 12 GLRSVDRNNKTTLPLTRPTGTIKSYAKDLTPRIVKL 119 GLRS RNNK T LTRP T KS AKD + R VKL Sbjct: 12 GLRSAARNNKATRLLTRPGYTSKSSAKDSSQRAVKL 47 Score = 37.4 bits (85), Expect(2) = 3e-06 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = +2 Query: 179 SGPKAYSYPTTMCGKKSPRSGMD 247 SG +AYSYP T C +KS RSGMD Sbjct: 67 SGAEAYSYPRTTCWRKSSRSGMD 89 >XP_013955648.1 hypothetical protein TRIVIDRAFT_180510, partial [Trichoderma virens Gv29-8] XP_013955653.1 hypothetical protein TRIVIDRAFT_180512, partial [Trichoderma virens Gv29-8] XP_013955657.1 hypothetical protein TRIVIDRAFT_170752, partial [Trichoderma virens Gv29-8] XP_013955661.1 hypothetical protein TRIVIDRAFT_170754, partial [Trichoderma virens Gv29-8] XP_013955665.1 hypothetical protein TRIVIDRAFT_180518, partial [Trichoderma virens Gv29-8] EHK21455.1 hypothetical protein TRIVIDRAFT_180510, partial [Trichoderma virens Gv29-8] EHK21460.1 hypothetical protein TRIVIDRAFT_180512, partial [Trichoderma virens Gv29-8] EHK21464.1 hypothetical protein TRIVIDRAFT_170752, partial [Trichoderma virens Gv29-8] EHK21468.1 hypothetical protein TRIVIDRAFT_170754, partial [Trichoderma virens Gv29-8] EHK21472.1 hypothetical protein TRIVIDRAFT_180518, partial [Trichoderma virens Gv29-8] Length = 62 Score = 48.5 bits (114), Expect = 8e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +3 Query: 12 GLRSVDRNNKTTLPLTRPTGTIKSYAKDLTPRIVKLQ 122 GL S DRNNK TL LT P T KS AKDLTP ++KLQ Sbjct: 7 GLPSADRNNKATLLLTGPFRTAKSSAKDLTPLVLKLQ 43