BLASTX nr result
ID: Glycyrrhiza30_contig00009997
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00009997 (556 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013457530.1 two-component response regulator-APRR2-like prote... 77 3e-13 XP_013457531.1 two-component response regulator-APRR2-like prote... 77 3e-13 >XP_013457530.1 two-component response regulator-APRR2-like protein [Medicago truncatula] KEH31561.1 two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 560 Score = 77.4 bits (189), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -1 Query: 250 ALSNANAVDYTFGLP-HSSIEHYPVMQYFPFSFFLLVHSGNWQVTSLHILIGAQMSYVVT 74 A+SNANA+DYTF + HSS + YPVMQYFPFSFFLL HS QVTSL+ILI + Sbjct: 478 AVSNANAMDYTFSMMLHSSFDDYPVMQYFPFSFFLLDHSSYMQVTSLYILIRT----ISC 533 Query: 73 CDEIV 59 CDEI+ Sbjct: 534 CDEII 538 >XP_013457531.1 two-component response regulator-APRR2-like protein [Medicago truncatula] KEH31562.1 two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 580 Score = 77.4 bits (189), Expect = 3e-13 Identities = 41/65 (63%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -1 Query: 250 ALSNANAVDYTFGLP-HSSIEHYPVMQYFPFSFFLLVHSGNWQVTSLHILIGAQMSYVVT 74 A+SNANA+DYTF + HSS + YPVMQYFPFSFFLL HS QVTSL+ILI + Sbjct: 498 AVSNANAMDYTFSMMLHSSFDDYPVMQYFPFSFFLLDHSSYMQVTSLYILIRT----ISC 553 Query: 73 CDEIV 59 CDEI+ Sbjct: 554 CDEII 558