BLASTX nr result
ID: Glycyrrhiza30_contig00009987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00009987 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004514717.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 107 2e-26 XP_012575490.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 107 2e-26 XP_013467335.1 thioredoxin [Medicago truncatula] KEH41372.1 thio... 94 2e-21 XP_013467334.1 thioredoxin [Medicago truncatula] KEH41371.1 thio... 93 4e-21 OAY38873.1 hypothetical protein MANES_10G049200 [Manihot esculenta] 93 6e-21 XP_015581933.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [R... 94 6e-21 XP_013467336.1 thioredoxin [Medicago truncatula] KEH41373.1 thio... 93 9e-21 OAY38875.1 hypothetical protein MANES_10G049200 [Manihot esculenta] 93 1e-20 OAY38874.1 hypothetical protein MANES_10G049200 [Manihot esculenta] 93 1e-20 XP_009385872.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [M... 91 4e-20 XP_018828851.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 90 7e-20 XP_004307366.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [F... 90 1e-19 GAV62528.1 Thioredoxin domain-containing protein [Cephalotus fol... 91 2e-19 XP_018828850.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 90 2e-19 XP_018828849.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 90 2e-19 XP_017603906.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 89 2e-19 XP_017603905.1 PREDICTED: thioredoxin-like 3-2, chloroplastic is... 89 3e-19 XP_012080950.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [J... 89 3e-19 XP_006574360.1 PREDICTED: uncharacterized protein LOC100527081 i... 89 5e-19 NP_001238403.1 uncharacterized protein LOC100527081 [Glycine max... 89 5e-19 >XP_004514717.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X2 [Cicer arietinum] Length = 188 Score = 107 bits (267), Expect = 2e-26 Identities = 47/61 (77%), Positives = 55/61 (90%) Frame = -3 Query: 183 NTVSFLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPR 4 ++VS L LQPICSEDHFDRV++E+ ++ H LVVWMASWCRKCI+LKPKLEKLAVDYYPR Sbjct: 65 DSVSSLHLQPICSEDHFDRVVAEAQRQQHALLVVWMASWCRKCIYLKPKLEKLAVDYYPR 124 Query: 3 L 1 L Sbjct: 125 L 125 >XP_012575490.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X1 [Cicer arietinum] Length = 189 Score = 107 bits (267), Expect = 2e-26 Identities = 47/61 (77%), Positives = 55/61 (90%) Frame = -3 Query: 183 NTVSFLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPR 4 ++VS L LQPICSEDHFDRV++E+ ++ H LVVWMASWCRKCI+LKPKLEKLAVDYYPR Sbjct: 65 DSVSSLHLQPICSEDHFDRVVAEAQRQQHALLVVWMASWCRKCIYLKPKLEKLAVDYYPR 124 Query: 3 L 1 L Sbjct: 125 L 125 >XP_013467335.1 thioredoxin [Medicago truncatula] KEH41372.1 thioredoxin [Medicago truncatula] Length = 148 Score = 93.6 bits (231), Expect = 2e-21 Identities = 43/60 (71%), Positives = 50/60 (83%) Frame = -3 Query: 183 NTVSFLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPR 4 ++V LQPICSEDHF+RVL++S H LVVWMA+WCRKCI+LKPKLEKLAVDYYPR Sbjct: 72 DSVVVSSLQPICSEDHFNRVLAQSQ---HALLVVWMANWCRKCIYLKPKLEKLAVDYYPR 128 >XP_013467334.1 thioredoxin [Medicago truncatula] KEH41371.1 thioredoxin [Medicago truncatula] Length = 152 Score = 92.8 bits (229), Expect = 4e-21 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -3 Query: 183 NTVSFLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPR 4 ++V LQPICSEDHF+RVL++S H LVVWMA+WCRKCI+LKPKLEKLAVDYYP Sbjct: 72 DSVVVSSLQPICSEDHFNRVLAQSQ---HALLVVWMANWCRKCIYLKPKLEKLAVDYYPS 128 Query: 3 L 1 L Sbjct: 129 L 129 >OAY38873.1 hypothetical protein MANES_10G049200 [Manihot esculenta] Length = 169 Score = 92.8 bits (229), Expect = 6e-21 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L+PICSE FDRV++E+ Q +VVWMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 90 VELEPICSESQFDRVIAEAQQLEESIIVVWMASWCRKCIYLKPKLEKLAADYYPRL 145 >XP_015581933.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [Ricinus communis] Length = 203 Score = 93.6 bits (231), Expect = 6e-21 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L PICSE FDRV++E+ Q P +++WMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 87 IELVPICSESQFDRVIAEAQQLEEPVIIIWMASWCRKCIYLKPKLEKLAADYYPRL 142 >XP_013467336.1 thioredoxin [Medicago truncatula] KEH41373.1 thioredoxin [Medicago truncatula] Length = 190 Score = 92.8 bits (229), Expect = 9e-21 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -3 Query: 183 NTVSFLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPR 4 ++V LQPICSEDHF+RVL++S H LVVWMA+WCRKCI+LKPKLEKLAVDYYP Sbjct: 72 DSVVVSSLQPICSEDHFNRVLAQSQ---HALLVVWMANWCRKCIYLKPKLEKLAVDYYPS 128 Query: 3 L 1 L Sbjct: 129 L 129 >OAY38875.1 hypothetical protein MANES_10G049200 [Manihot esculenta] Length = 200 Score = 92.8 bits (229), Expect = 1e-20 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L+PICSE FDRV++E+ Q +VVWMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 90 VELEPICSESQFDRVIAEAQQLEESIIVVWMASWCRKCIYLKPKLEKLAADYYPRL 145 >OAY38874.1 hypothetical protein MANES_10G049200 [Manihot esculenta] Length = 206 Score = 92.8 bits (229), Expect = 1e-20 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L+PICSE FDRV++E+ Q +VVWMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 90 VELEPICSESQFDRVIAEAQQLEESIIVVWMASWCRKCIYLKPKLEKLAADYYPRL 145 >XP_009385872.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [Musa acuminata subsp. malaccensis] Length = 197 Score = 91.3 bits (225), Expect = 4e-20 Identities = 36/54 (66%), Positives = 47/54 (87%) Frame = -3 Query: 162 LQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 L+PI SE+HFDR+++E+HQ P +V+WMASWCRKCI+LKPKLEKLA +YYP + Sbjct: 85 LEPIVSEEHFDRIIAEAHQLEEPIVVLWMASWCRKCIYLKPKLEKLAAEYYPSI 138 >XP_018828851.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X3 [Juglans regia] Length = 160 Score = 89.7 bits (221), Expect = 7e-20 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L PICSE FDRVL+E+ Q ++VWMASWCRKCI+LKPKLEKLA D+YPR+ Sbjct: 82 VELHPICSETQFDRVLAEAQQLEESIIIVWMASWCRKCIYLKPKLEKLAADFYPRI 137 >XP_004307366.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [Fragaria vesca subsp. vesca] Length = 194 Score = 90.1 bits (222), Expect = 1e-19 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 + L PICSE FDRV++++ Q PF+VVW+ASWCRKCI+LKPKLEKLA +YYPRL Sbjct: 77 VDLVPICSEAQFDRVVAQAQQLRQPFVVVWIASWCRKCIYLKPKLEKLAAEYYPRL 132 >GAV62528.1 Thioredoxin domain-containing protein [Cephalotus follicularis] Length = 244 Score = 90.9 bits (224), Expect = 2e-19 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 +QL+PICSE FDRV++E+ Q +VVWMASWCRKCI+LKPKLEKLA DYYP L Sbjct: 127 IQLEPICSETQFDRVIAEAQQLEQSVIVVWMASWCRKCIYLKPKLEKLACDYYPTL 182 >XP_018828850.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X2 [Juglans regia] Length = 197 Score = 89.7 bits (221), Expect = 2e-19 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L PICSE FDRVL+E+ Q ++VWMASWCRKCI+LKPKLEKLA D+YPR+ Sbjct: 82 VELHPICSETQFDRVLAEAQQLEESIIIVWMASWCRKCIYLKPKLEKLAADFYPRI 137 >XP_018828849.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X1 [Juglans regia] Length = 198 Score = 89.7 bits (221), Expect = 2e-19 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L PICSE FDRVL+E+ Q ++VWMASWCRKCI+LKPKLEKLA D+YPR+ Sbjct: 82 VELHPICSETQFDRVLAEAQQLEESIIIVWMASWCRKCIYLKPKLEKLAADFYPRI 137 >XP_017603906.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X2 [Gossypium arboreum] KHG26993.1 Thioredoxin-like 3-2, chloroplastic [Gossypium arboreum] Length = 197 Score = 89.4 bits (220), Expect = 2e-19 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++LQ ICSE FDRV++E+ Q +++WMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 87 VELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAADYYPRL 142 >XP_017603905.1 PREDICTED: thioredoxin-like 3-2, chloroplastic isoform X1 [Gossypium arboreum] Length = 203 Score = 89.4 bits (220), Expect = 3e-19 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++LQ ICSE FDRV++E+ Q +++WMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 87 VELQQICSESQFDRVIAEAQQLEESLIILWMASWCRKCIYLKPKLEKLAADYYPRL 142 >XP_012080950.1 PREDICTED: thioredoxin-like 3-2, chloroplastic [Jatropha curcas] Length = 212 Score = 89.4 bits (220), Expect = 3e-19 Identities = 37/56 (66%), Positives = 46/56 (82%) Frame = -3 Query: 168 LQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 ++L+ ICSE FDRV++E+ Q ++VWMASWCRKCI+LKPKLEKLA DYYPRL Sbjct: 96 IELETICSESQFDRVIAEAQQLEEAVIIVWMASWCRKCIYLKPKLEKLAADYYPRL 151 >XP_006574360.1 PREDICTED: uncharacterized protein LOC100527081 isoform X1 [Glycine max] XP_006574361.1 PREDICTED: uncharacterized protein LOC100527081 isoform X1 [Glycine max] KHN04663.1 Thioredoxin-like 3-2, chloroplastic [Glycine soja] KRH71653.1 hypothetical protein GLYMA_02G161200 [Glycine max] Length = 198 Score = 88.6 bits (218), Expect = 5e-19 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = -3 Query: 171 FLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 FL LQPI SE+HFDRVL+++ +VVWMA+WCRKCI+LKPKLEKLA +YYPRL Sbjct: 75 FLYLQPISSENHFDRVLAKAQTLDEGVVVVWMANWCRKCIYLKPKLEKLAAEYYPRL 131 >NP_001238403.1 uncharacterized protein LOC100527081 [Glycine max] ACU16123.1 unknown [Glycine max] Length = 198 Score = 88.6 bits (218), Expect = 5e-19 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = -3 Query: 171 FLQLQPICSEDHFDRVLSESHQRHHPFLVVWMASWCRKCIFLKPKLEKLAVDYYPRL 1 FL LQPI SE+HFDRVL+++ +VVWMA+WCRKCI+LKPKLEKLA +YYPRL Sbjct: 75 FLYLQPISSENHFDRVLAKAQTLDEGVVVVWMANWCRKCIYLKPKLEKLAAEYYPRL 131