BLASTX nr result
ID: Glycyrrhiza30_contig00009655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00009655 (609 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017422393.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 70 1e-10 XP_014501956.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 70 1e-10 XP_007137365.1 hypothetical protein PHAVU_009G121200g [Phaseolus... 70 1e-10 KOM41633.1 hypothetical protein LR48_Vigan04g183100 [Vigna angul... 70 1e-10 XP_008444125.1 PREDICTED: LOW QUALITY PROTEIN: phosphatidylinosi... 70 2e-10 XP_004150913.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 70 2e-10 KRG94464.1 hypothetical protein GLYMA_19G086900 [Glycine max] 66 3e-10 XP_008465818.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 69 4e-10 XP_004140328.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 69 4e-10 XP_014504907.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 69 5e-10 XP_007141094.1 hypothetical protein PHAVU_008G166900g [Phaseolus... 69 5e-10 XP_004290830.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 69 5e-10 OAY58225.1 hypothetical protein MANES_02G159700 [Manihot esculenta] 69 5e-10 KHN09172.1 Phosphatidylinositol-4-phosphate 5-kinase 1 [Glycine ... 68 6e-10 XP_003522588.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 68 6e-10 XP_003526609.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 68 6e-10 XP_012446760.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 68 6e-10 XP_017610176.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 68 6e-10 CDP12435.1 unnamed protein product [Coffea canephora] 68 6e-10 XP_016181174.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kin... 68 6e-10 >XP_017422393.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2 isoform X1 [Vigna angularis] BAT78582.1 hypothetical protein VIGAN_02127700 [Vigna angularis var. angularis] Length = 722 Score = 70.1 bits (170), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 689 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 722 >XP_014501956.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2 isoform X1 [Vigna radiata var. radiata] Length = 722 Score = 70.1 bits (170), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 689 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 722 >XP_007137365.1 hypothetical protein PHAVU_009G121200g [Phaseolus vulgaris] ESW09359.1 hypothetical protein PHAVU_009G121200g [Phaseolus vulgaris] Length = 722 Score = 70.1 bits (170), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 689 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 722 >KOM41633.1 hypothetical protein LR48_Vigan04g183100 [Vigna angularis] Length = 755 Score = 70.1 bits (170), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 689 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 722 >XP_008444125.1 PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cucumis melo] Length = 789 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 756 KSLQVDPSSISAVDPKLYSKRFRDFIGRIFIEDR 789 >XP_004150913.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Cucumis sativus] KGN54591.1 hypothetical protein Csa_4G372620 [Cucumis sativus] Length = 791 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 758 KSLQVDPSSISAVDPKLYSKRFRDFIGRIFIEDR 791 >KRG94464.1 hypothetical protein GLYMA_19G086900 [Glycine max] Length = 162 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 509 KSLQVDPSSIS VDPKLYSKRFRDFVGRIFIED Sbjct: 129 KSLQVDPSSISIVDPKLYSKRFRDFVGRIFIED 161 >XP_008465818.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Cucumis melo] Length = 786 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 753 KSLQVDPTSISAVDPKLYSKRFRDFVGRIFIEDR 786 >XP_004140328.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Cucumis sativus] KGN50974.1 hypothetical protein Csa_5G381800 [Cucumis sativus] Length = 786 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDFVGRIFIEDR Sbjct: 753 KSLQVDPTSISAVDPKLYSKRFRDFVGRIFIEDR 786 >XP_014504907.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Vigna radiata var. radiata] Length = 709 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIE+R Sbjct: 676 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEER 709 >XP_007141094.1 hypothetical protein PHAVU_008G166900g [Phaseolus vulgaris] ESW13088.1 hypothetical protein PHAVU_008G166900g [Phaseolus vulgaris] Length = 709 Score = 68.6 bits (166), Expect = 5e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIE+R Sbjct: 676 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEER 709 >XP_004290830.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1 [Fragaria vesca subsp. vesca] Length = 768 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 735 KSLQVDPTSISAVDPKLYSKRFRDFIGRIFIEDR 768 >OAY58225.1 hypothetical protein MANES_02G159700 [Manihot esculenta] Length = 783 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDF+GRIFIEDR Sbjct: 750 KSLQVDPTSISAVDPKLYSKRFRDFIGRIFIEDR 783 >KHN09172.1 Phosphatidylinositol-4-phosphate 5-kinase 1 [Glycine soja] Length = 453 Score = 68.2 bits (165), Expect = 6e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 509 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED Sbjct: 420 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 452 >XP_003522588.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] KRH64735.1 hypothetical protein GLYMA_04G253100 [Glycine max] Length = 702 Score = 68.2 bits (165), Expect = 6e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 509 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED Sbjct: 669 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 701 >XP_003526609.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Glycine max] KRH53182.1 hypothetical protein GLYMA_06G109400 [Glycine max] Length = 717 Score = 68.2 bits (165), Expect = 6e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 509 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED Sbjct: 684 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIED 716 >XP_012446760.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Gossypium raimondii] KJB59964.1 hypothetical protein B456_009G283000 [Gossypium raimondii] Length = 729 Score = 68.2 bits (165), Expect = 6e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDF+GRIF+EDR Sbjct: 696 KSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 729 >XP_017610176.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 1-like [Gossypium arboreum] KHG26589.1 Phosphatidylinositol-4-phosphate 5-kinase 1 -like protein [Gossypium arboreum] Length = 729 Score = 68.2 bits (165), Expect = 6e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDF+GRIF+EDR Sbjct: 696 KSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 729 >CDP12435.1 unnamed protein product [Coffea canephora] Length = 747 Score = 68.2 bits (165), Expect = 6e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDF+GRIF+EDR Sbjct: 714 KSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 747 >XP_016181174.1 PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 2-like [Arachis ipaensis] Length = 749 Score = 68.2 bits (165), Expect = 6e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 607 KSLQVDPSSISAVDPKLYSKRFRDFVGRIFIEDR 506 KSLQVDP+SISAVDPKLYSKRFRDF+GRIF+EDR Sbjct: 716 KSLQVDPTSISAVDPKLYSKRFRDFIGRIFVEDR 749