BLASTX nr result
ID: Glycyrrhiza30_contig00009523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00009523 (452 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494256.1 PREDICTED: syntaxin-121-like [Cicer arietinum] 60 5e-08 EJL22243.1 hypothetical protein PMI02_04793, partial [Novosphing... 53 3e-06 WP_073495734.1 hypothetical protein [Enterococcus faecalis] 51 7e-06 >XP_004494256.1 PREDICTED: syntaxin-121-like [Cicer arietinum] Length = 292 Score = 60.5 bits (145), Expect = 5e-08 Identities = 33/58 (56%), Positives = 39/58 (67%), Gaps = 4/58 (6%) Frame = +3 Query: 255 MNDLLSES----HVIQMAEGTTGAATSLGKFFEEVEAVKEDLKELQGLQIGRASCRER 416 MNDLLS HVIQMAE +TG A SL KFFEE+EAVKE+L EL+ L + E+ Sbjct: 1 MNDLLSADNNHRHVIQMAENSTGTAISLEKFFEEIEAVKEELNELEKLHVRLRKSHEK 58 >EJL22243.1 hypothetical protein PMI02_04793, partial [Novosphingobium sp. AP12] Length = 97 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 451 FFNDTATTEIYTLSLHDALPIWR 383 FFNDTATTEIYTLSLHDALPIWR Sbjct: 1 FFNDTATTEIYTLSLHDALPIWR 23 >WP_073495734.1 hypothetical protein [Enterococcus faecalis] Length = 67 Score = 50.8 bits (120), Expect = 7e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 451 FFNDTATTEIYTLSLHDALPIW 386 FFNDTATTEIYTLSLHDALPIW Sbjct: 14 FFNDTATTEIYTLSLHDALPIW 35