BLASTX nr result
ID: Glycyrrhiza30_contig00008350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00008350 (378 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003607620.2 disease resistance protein (TIR-NBS-LRR class), p... 70 2e-11 XP_003607694.1 disease resistance protein (TIR-NBS-LRR class) [M... 58 2e-07 XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), p... 57 4e-07 GAU40524.1 hypothetical protein TSUD_92960 [Trifolium subterraneum] 56 1e-06 >XP_003607620.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89817.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1055 Score = 69.7 bits (169), Expect = 2e-11 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = +1 Query: 1 DVKMQQTYIDYPCLDMEVINCGYHWVFKEDLQR---MHCGNSLARKRKFLAIEDKA 159 D+ M+ + + LD+EV NCGYHWV+K DLQ MH GNS+ARKRKFLAIED+A Sbjct: 998 DINMKASIMKGQGLDLEVQNCGYHWVYKPDLQELTMMHPGNSVARKRKFLAIEDEA 1053 >XP_003607694.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] AES89891.1 disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula] Length = 962 Score = 58.2 bits (139), Expect = 2e-07 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 8/61 (13%) Frame = +1 Query: 1 DVKMQQTYIDYPC----LDMEVINCGYHWVFKEDLQ----RMHCGNSLARKRKFLAIEDK 156 DV + +++ C L +EV NCGY W++K+DLQ +M+ GNSLA KRKFL IED+ Sbjct: 889 DVLNETLFVEIACFEDYLGIEVKNCGYRWIYKQDLQELNYKMNHGNSLAGKRKFLEIEDE 948 Query: 157 A 159 A Sbjct: 949 A 949 >XP_003607698.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] AES89895.2 disease resistance protein (TIR-NBS-LRR class), putative [Medicago truncatula] Length = 1157 Score = 57.4 bits (137), Expect = 4e-07 Identities = 28/58 (48%), Positives = 37/58 (63%), Gaps = 5/58 (8%) Frame = +1 Query: 1 DVKMQQTYIDYPCLDMEVINCGYHWVFKEDLQR-----MHCGNSLARKRKFLAIEDKA 159 D++M+ +D LD+EV NCGY WV+K DLQ MHC +SLA+ L IED+A Sbjct: 1023 DIRMEVLIVDGEGLDVEVKNCGYRWVYKHDLQHLNFTMMHCKSSLAQNCDILGIEDEA 1080 >GAU40524.1 hypothetical protein TSUD_92960 [Trifolium subterraneum] Length = 347 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 40 LDMEVINCGYHWVFKEDLQRMH-CGNSLARKRKFLAIEDKA 159 +D++V +CGY WV+K+DLQ H CGN L RK KFLAIED+A Sbjct: 296 MDVKVQSCGYRWVYKQDLQLKHGCGNFLDRKCKFLAIEDEA 336