BLASTX nr result
ID: Glycyrrhiza30_contig00008006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00008006 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gela... 76 4e-16 XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes v... 64 1e-11 XP_007928849.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 61 2e-09 XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [D... 57 7e-09 XP_014072464.1 hypothetical protein COCC4DRAFT_67253 [Bipolaris ... 53 3e-07 EUB55374.1 rRNA promoter binding protein [Echinococcus granulosus] 53 4e-06 XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [... 49 6e-06 >EMD31869.1 hypothetical protein CERSUDRAFT_162701, partial [Gelatoporia subvermispora B] Length = 87 Score = 75.9 bits (185), Expect = 4e-16 Identities = 37/58 (63%), Positives = 41/58 (70%) Frame = -1 Query: 284 PLCQHPKLERGRTPAIKASCIPQSQPTYSAGGYNTPEGATFLQLFSVGQN*C*PAQGK 111 PL QHPK ERGRTP IKA C P+SQP+Y+ GYNTPEGATF FS +N C P K Sbjct: 16 PLRQHPKHERGRTPTIKACCEPRSQPSYATEGYNTPEGATFPLPFSDDRNRCWPVDRK 73 >XP_008045700.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] EIW51413.1 hypothetical protein TRAVEDRAFT_41087 [Trametes versicolor FP-101664 SS1] Length = 51 Score = 63.5 bits (153), Expect = 1e-11 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 245 PAIKASCIPQSQPTYSAGGYNTPEGATFLQLFSVGQN*C*PAQGK 111 P+ KA C+P+SQP Y+ GYNTPEGATFLQ FS GQN C P K Sbjct: 5 PSHKARCVPRSQPLYATEGYNTPEGATFLQPFSSGQNRCWPVNRK 49 >XP_007928849.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] EME80501.1 hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 61.2 bits (147), Expect = 2e-09 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 7/67 (10%) Frame = -3 Query: 180 TRGCHLPPT------LFRRSELMLTRTRQIHRQR-RLNTKCTTDFNRFPFNNFTCCLTLF 22 TRG + P L +RS+ M+ R+++R R NT + RFPFNNFTC LTLF Sbjct: 34 TRGYNTPRRELHSSGLIQRSQTMMASRRRVNRSEDRPNTAAKSGCGRFPFNNFTCFLTLF 93 Query: 21 PKCFSSF 1 PKCFSSF Sbjct: 94 PKCFSSF 100 >XP_007371719.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] EJF55541.1 hypothetical protein DICSQDRAFT_73579, partial [Dichomitus squalens LYAD-421 SS1] Length = 59 Score = 56.6 bits (135), Expect = 7e-09 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = -1 Query: 245 PAIKASCIPQSQPTYSAGGYNTPEGATFLQLFSVGQN*C*PAQGK 111 P + A C+P+SQP Y+ YNTPEGAT LQ FS GQN C P K Sbjct: 1 PCLAARCVPRSQPPYATRVYNTPEGATLLQPFSDGQNRCWPVNRK 45 >XP_014072464.1 hypothetical protein COCC4DRAFT_67253 [Bipolaris maydis ATCC 48331] EMD91247.1 hypothetical protein COCHEDRAFT_1156575 [Bipolaris maydis C5] ENH98554.1 hypothetical protein COCC4DRAFT_67253 [Bipolaris maydis ATCC 48331] Length = 70 Score = 52.8 bits (125), Expect = 3e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 63 RFPFNNFTCCLTLFPKCFSSF 1 RFPFNNFTCCLTLFPKCFSSF Sbjct: 10 RFPFNNFTCCLTLFPKCFSSF 30 >EUB55374.1 rRNA promoter binding protein [Echinococcus granulosus] Length = 742 Score = 53.1 bits (126), Expect = 4e-06 Identities = 25/38 (65%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -3 Query: 111 IHRQR-RLNTKCTTDFNRFPFNNFTCCLTLFPKCFSSF 1 +HR RLN + RFPFNNFTCCLTLF KCFSSF Sbjct: 357 VHRHECRLNPVGESGRKRFPFNNFTCCLTLFSKCFSSF 394 >XP_006455549.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] XP_006458829.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] XP_007335029.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKM74328.1 hypothetical protein AGABI1DRAFT_48203, partial [Agaricus bisporus var. burnettii JB137-S8] EKV41603.1 hypothetical protein AGABI2DRAFT_80166, partial [Agaricus bisporus var. bisporus H97] EKV44288.1 hypothetical protein AGABI2DRAFT_75872, partial [Agaricus bisporus var. bisporus H97] Length = 51 Score = 48.9 bits (115), Expect = 6e-06 Identities = 21/25 (84%), Positives = 22/25 (88%) Frame = -3 Query: 75 TDFNRFPFNNFTCCLTLFPKCFSSF 1 TDF RFPF+NFT CLTLFPK FSSF Sbjct: 4 TDFKRFPFSNFTYCLTLFPKFFSSF 28