BLASTX nr result
ID: Glycyrrhiza30_contig00007960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00007960 (466 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP74705.1 Pentatricopeptide repeat-containing protein At4g13650... 61 6e-08 XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-cont... 60 2e-07 XP_016188951.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-07 XP_015954426.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-07 >KYP74705.1 Pentatricopeptide repeat-containing protein At4g13650 family [Cajanus cajan] Length = 815 Score = 60.8 bits (146), Expect = 6e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 345 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAK 464 GDCT+ ALN+G +IH H LK+GV+P +HFW SL+NF AK Sbjct: 10 GDCTLREALNDGKAIHGHQLKNGVEPDSHFWASLINFYAK 49 >XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Lupinus angustifolius] Length = 978 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 345 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAK 464 GDC + +LNEG++IH H +K+GVD HFWISL+NF AK Sbjct: 111 GDCALRESLNEGMAIHGHRIKNGVDQDTHFWISLINFYAK 150 >XP_016188951.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188952.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188953.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188954.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] XP_016188955.1 PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Arachis ipaensis] Length = 963 Score = 58.5 bits (140), Expect = 4e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 345 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAK 464 G+C + ALNEG +IH H +K+GVDP +HFW+SL+N AK Sbjct: 95 GNCALRGALNEGKAIHGHQIKTGVDPDSHFWVSLINLYAK 134 >XP_015954426.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] XP_015954427.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] XP_015954428.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] XP_015954429.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Arachis duranensis] Length = 963 Score = 58.5 bits (140), Expect = 4e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 345 GDCTMNAALNEGLSIHEHHLKSGVDPYAHFWISLLNFSAK 464 G+C + ALNEG +IH H +K+GVDP +HFW+SL+N AK Sbjct: 95 GNCALRGALNEGKAIHGHQIKTGVDPDSHFWVSLINLYAK 134