BLASTX nr result
ID: Glycyrrhiza30_contig00007765
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00007765 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012574682.1 PREDICTED: uncharacterized protein LOC101493031 [... 60 3e-08 XP_013463279.1 transcription termination factor family protein [... 56 6e-07 XP_019418191.1 PREDICTED: uncharacterized protein LOC109328990 [... 55 1e-06 GAU45529.1 hypothetical protein TSUD_400760 [Trifolium subterran... 53 8e-06 >XP_012574682.1 PREDICTED: uncharacterized protein LOC101493031 [Cicer arietinum] Length = 398 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 199 VSYLVDTVGLPRETALKASKRLRFKTSEKPDSVFAF 306 VSYL++T+G PRETALKASKRLRF + EKP+SVF F Sbjct: 57 VSYLINTIGFPRETALKASKRLRFNSPEKPNSVFTF 92 >XP_013463279.1 transcription termination factor family protein [Medicago truncatula] KEH37291.1 transcription termination factor family protein [Medicago truncatula] Length = 387 Score = 55.8 bits (133), Expect = 6e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 199 VSYLVDTVGLPRETALKASKRLRFKTSEKPDSVFAF 306 VSYL++T+G PRE ALKASKRLRF + +KP+SVF F Sbjct: 47 VSYLINTIGFPREAALKASKRLRFNSPQKPNSVFNF 82 >XP_019418191.1 PREDICTED: uncharacterized protein LOC109328990 [Lupinus angustifolius] OIV95598.1 hypothetical protein TanjilG_23829 [Lupinus angustifolius] Length = 359 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +1 Query: 199 VSYLVDTVGLPRETALKASKRLRFKTSEKPDSVFAF 306 VSYL++ +G ETALKASKRLRF TS+KPDSV AF Sbjct: 35 VSYLINNLGFSSETALKASKRLRFNTSQKPDSVLAF 70 >GAU45529.1 hypothetical protein TSUD_400760 [Trifolium subterraneum] Length = 390 Score = 52.8 bits (125), Expect = 8e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 199 VSYLVDTVGLPRETALKASKRLRFKTSEKPDSVFAF 306 VSYL++ +G RETALKASKR+R K+ EKP+SVF F Sbjct: 50 VSYLINNIGFTRETALKASKRVRIKSLEKPNSVFTF 85