BLASTX nr result
ID: Glycyrrhiza30_contig00007572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00007572 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP64687.1 Transmembrane emp24 domain-containing protein 10 [Caj... 86 4e-19 GAU19798.1 hypothetical protein TSUD_170220 [Trifolium subterran... 84 7e-19 XP_003621291.1 emp24/gp25L/p24 family protein [Medicago truncatu... 86 8e-19 GAU19797.1 hypothetical protein TSUD_170230 [Trifolium subterran... 84 1e-18 XP_004491839.1 PREDICTED: transmembrane emp24 domain-containing ... 82 1e-17 AFK33589.1 unknown [Lotus japonicus] 81 4e-17 GAU31810.1 hypothetical protein TSUD_58110 [Trifolium subterraneum] 80 1e-16 XP_004489416.1 PREDICTED: transmembrane emp24 domain-containing ... 78 8e-16 XP_019442683.1 PREDICTED: transmembrane emp24 domain-containing ... 77 1e-15 XP_016181220.1 PREDICTED: transmembrane emp24 domain-containing ... 77 2e-15 XP_015946145.1 PREDICTED: transmembrane emp24 domain-containing ... 77 2e-15 KHN13205.1 Transmembrane emp24 domain-containing protein 10 [Gly... 77 2e-15 NP_001237845.1 uncharacterized protein LOC100527303 precursor [G... 77 2e-15 GAU37502.1 hypothetical protein TSUD_275540 [Trifolium subterran... 75 4e-15 KHN13596.1 Transmembrane emp24 domain-containing protein 10 [Gly... 76 5e-15 XP_019454951.1 PREDICTED: transmembrane emp24 domain-containing ... 76 6e-15 XP_003618538.1 emp24/gp25L/p24 family protein [Medicago truncatu... 75 9e-15 ACJ85043.1 unknown [Medicago truncatula] AFK39244.1 unknown [Med... 75 9e-15 ONK75420.1 uncharacterized protein A4U43_C03F16660 [Asparagus of... 75 1e-14 XP_015962407.1 PREDICTED: transmembrane emp24 domain-containing ... 75 1e-14 >KYP64687.1 Transmembrane emp24 domain-containing protein 10 [Cajanus cajan] Length = 214 Score = 86.3 bits (212), Expect = 4e-19 Identities = 39/59 (66%), Positives = 48/59 (81%) Frame = +1 Query: 73 MLHPILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 M +PI L+L ++APALMC+ VNS++ +K G PKCISEDIKSN +TVGKY VVNPN GY Sbjct: 1 MSNPINLLLLLLAPALMCTIVNSLQLEMKSGHPKCISEDIKSNVITVGKYHVVNPNPGY 59 >GAU19798.1 hypothetical protein TSUD_170220 [Trifolium subterraneum] Length = 144 Score = 84.0 bits (206), Expect = 7e-19 Identities = 38/55 (69%), Positives = 47/55 (85%) Frame = +1 Query: 85 ILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 ++L+L I+P LMCSFVNSMRF+LK G+PKCI+E+IK NA+TVG Y VVNP EGY Sbjct: 4 LILLLISISPTLMCSFVNSMRFDLKSGEPKCITEEIKGNALTVGDYSVVNPIEGY 58 >XP_003621291.1 emp24/gp25L/p24 family protein [Medicago truncatula] ABN08259.1 emp24/gp25L/p24 [Medicago truncatula] AES77509.1 emp24/gp25L/p24 family protein [Medicago truncatula] Length = 212 Score = 85.5 bits (210), Expect = 8e-19 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = +1 Query: 73 MLHPILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 ML+ ILL++ I+ PALMC+ VNSMRF+LK G PKCI E+I SNAMTVG Y VVNPNEGY Sbjct: 1 MLNSILLLIAIV-PALMCNVVNSMRFDLKSGNPKCIVEEIMSNAMTVGNYSVVNPNEGY 58 >GAU19797.1 hypothetical protein TSUD_170230 [Trifolium subterraneum] Length = 170 Score = 84.0 bits (206), Expect = 1e-18 Identities = 38/55 (69%), Positives = 47/55 (85%) Frame = +1 Query: 85 ILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 ++L+L I+P LMCSFVNSMRF+LK G+PKCI+E+IK NA+TVG Y VVNP EGY Sbjct: 4 LILLLISISPTLMCSFVNSMRFDLKSGEPKCITEEIKGNALTVGDYSVVNPIEGY 58 >XP_004491839.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta9-like [Cicer arietinum] Length = 212 Score = 82.4 bits (202), Expect = 1e-17 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +1 Query: 73 MLHPILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 M + I L++ +++ LMCSFVNSMRFNL QPKCI+EDIK NAMT+GKY VVN NEGY Sbjct: 1 MFNSIFLIVVVVS-TLMCSFVNSMRFNLNSDQPKCITEDIKRNAMTIGKYSVVNLNEGY 58 >AFK33589.1 unknown [Lotus japonicus] Length = 214 Score = 81.3 bits (199), Expect = 4e-17 Identities = 38/59 (64%), Positives = 45/59 (76%) Frame = +1 Query: 73 MLHPILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 ML+ ILL+ + AL CS NS+RF LK G KCI+EDIKSNAM+VGKY +VNPNEGY Sbjct: 1 MLNSILLLAAFLTLALTCSLANSLRFELKSGHSKCITEDIKSNAMSVGKYSIVNPNEGY 59 >GAU31810.1 hypothetical protein TSUD_58110 [Trifolium subterraneum] Length = 212 Score = 80.1 bits (196), Expect = 1e-16 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +1 Query: 88 LLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L+L I AL+ SFVNSMRF +K G+PKCI+EDI SNAMTVG Y VVNPNEGY Sbjct: 5 ILLLVAIFHALLFSFVNSMRFEIKSGEPKCITEDIMSNAMTVGNYSVVNPNEGY 58 >XP_004489416.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta9 [Cicer arietinum] Length = 213 Score = 77.8 bits (190), Expect = 8e-16 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = +1 Query: 88 LLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L+L+I+ SFVNSMRF L+ G KCISEDIKSNAMTVGKY VVNPNEGY Sbjct: 5 ILLLSILTLTSTFSFVNSMRFELQSGHTKCISEDIKSNAMTVGKYSVVNPNEGY 58 >XP_019442683.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta9-like [Lupinus angustifolius] OIW12460.1 hypothetical protein TanjilG_04209 [Lupinus angustifolius] Length = 212 Score = 77.4 bits (189), Expect = 1e-15 Identities = 35/55 (63%), Positives = 44/55 (80%) Frame = +1 Query: 85 ILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 ++L+L + +LMCS NSMRF LK G KCIS++I+SN+MTVGKY VVNPNEGY Sbjct: 4 LILLLAFLTLSLMCSIANSMRFELKYGDTKCISDEIQSNSMTVGKYTVVNPNEGY 58 >XP_016181220.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta7 [Arachis ipaensis] Length = 212 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = +1 Query: 94 VLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L I ALMC NSMRF L+ GQ KCI+E+IKSNAMTVGKY VVNP+EGY Sbjct: 7 LLAFITLALMCGITNSMRFELRSGQTKCIAEEIKSNAMTVGKYSVVNPSEGY 58 >XP_015946145.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta7-like [Arachis duranensis] Length = 212 Score = 77.0 bits (188), Expect = 2e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +1 Query: 94 VLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L I ALMC NSMRF L+ G KCI+E+IKSNAMTVGKY VVNPNEGY Sbjct: 7 LLAFITLALMCGITNSMRFELRSGHTKCIAEEIKSNAMTVGKYSVVNPNEGY 58 >KHN13205.1 Transmembrane emp24 domain-containing protein 10 [Glycine soja] KRH18453.1 hypothetical protein GLYMA_13G061200 [Glycine max] Length = 216 Score = 76.6 bits (187), Expect = 2e-15 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +1 Query: 97 LTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 L +++ A+MCS NSMRF+L+ GQ KCISEDIK+NAM+VGKY VVNP EGY Sbjct: 11 LALLSLAVMCSVANSMRFDLQSGQTKCISEDIKTNAMSVGKYSVVNPQEGY 61 >NP_001237845.1 uncharacterized protein LOC100527303 precursor [Glycine max] ACU16374.1 unknown [Glycine max] Length = 216 Score = 76.6 bits (187), Expect = 2e-15 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +1 Query: 97 LTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 L +++ A+MCS NSMRF+L+ GQ KCISEDIK+NAM+VGKY VVNP EGY Sbjct: 11 LALLSLAVMCSVANSMRFDLQSGQTKCISEDIKTNAMSVGKYSVVNPQEGY 61 >GAU37502.1 hypothetical protein TSUD_275540 [Trifolium subterraneum] Length = 169 Score = 75.1 bits (183), Expect = 4e-15 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +1 Query: 88 LLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L+L I+ L C+ VNSMRF L+ G KCISE+IK+NAMTVGKY VVNPNE Y Sbjct: 7 ILLLAILTLTLTCNVVNSMRFELQSGHTKCISEEIKTNAMTVGKYSVVNPNEAY 60 >KHN13596.1 Transmembrane emp24 domain-containing protein 10 [Glycine soja] Length = 218 Score = 75.9 bits (185), Expect = 5e-15 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = +1 Query: 79 HPILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPN 240 H +L + ++APALM S VNSMRF LK GQ KCISED+KSN +TVG Y+V+NPN Sbjct: 6 HIHILRVLLLAPALMASIVNSMRFELKSGQSKCISEDLKSNVITVGNYYVLNPN 59 >XP_019454951.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta9-like [Lupinus angustifolius] Length = 233 Score = 75.9 bits (185), Expect = 6e-15 Identities = 37/70 (52%), Positives = 50/70 (71%), Gaps = 2/70 (2%) Frame = +1 Query: 46 SQIEDSVVQMLHPIL--LVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGK 219 S I+++++ + + L+ +IA LM FVNS++F LK G KCISEDIK NA+TVGK Sbjct: 10 SSIQENIISTMSNSIPFLLFKVIASTLMFRFVNSLQFELKSGHTKCISEDIKHNAVTVGK 69 Query: 220 YFVVNPNEGY 249 Y VVNPN+GY Sbjct: 70 YSVVNPNDGY 79 >XP_003618538.1 emp24/gp25L/p24 family protein [Medicago truncatula] AES74756.1 emp24/gp25L/p24 family protein [Medicago truncatula] Length = 212 Score = 75.1 bits (183), Expect = 9e-15 Identities = 39/54 (72%), Positives = 44/54 (81%) Frame = +1 Query: 88 LLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L+L I+ AL SFVNSMRF+L+ G KCISEDIK NAMTVGKY VVNPNEGY Sbjct: 5 ILLLAILTLALT-SFVNSMRFDLQMGSTKCISEDIKINAMTVGKYSVVNPNEGY 57 >ACJ85043.1 unknown [Medicago truncatula] AFK39244.1 unknown [Medicago truncatula] Length = 212 Score = 75.1 bits (183), Expect = 9e-15 Identities = 39/54 (72%), Positives = 44/54 (81%) Frame = +1 Query: 88 LLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 +L+L I+ AL SFVNSMRF+L+ G KCISEDIK NAMTVGKY VVNPNEGY Sbjct: 5 ILLLAILTLALT-SFVNSMRFDLQMGSTKCISEDIKINAMTVGKYSVVNPNEGY 57 >ONK75420.1 uncharacterized protein A4U43_C03F16660 [Asparagus officinalis] Length = 210 Score = 74.7 bits (182), Expect = 1e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = +1 Query: 73 MLHPILLVLTIIAPALMCSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVNPNEGY 249 M P+L +L+ + L+ S +S+RF+L+ G PKCISEDIK NAM VGKYFVVNPNEGY Sbjct: 1 MAQPLLRLLSAL---LLLSLASSLRFDLQSGSPKCISEDIKMNAMAVGKYFVVNPNEGY 56 >XP_015962407.1 PREDICTED: transmembrane emp24 domain-containing protein p24delta7 [Arachis duranensis] Length = 221 Score = 74.7 bits (182), Expect = 1e-14 Identities = 34/65 (52%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = +1 Query: 58 DSVVQMLHPILLVLTIIAPALM-CSFVNSMRFNLKPGQPKCISEDIKSNAMTVGKYFVVN 234 +S+ LH +LL++ ++AP+L+ CS V S++ LK G KCISE+I NAM+VG Y +VN Sbjct: 3 NSIHLHLHHLLLLIVVVAPSLLLCSLVESVQLELKSGHTKCISEEISDNAMSVGNYIIVN 62 Query: 235 PNEGY 249 PNEGY Sbjct: 63 PNEGY 67