BLASTX nr result
ID: Glycyrrhiza30_contig00007563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00007563 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU24194.1 unknown [Glycine max] 86 1e-18 KYP45941.1 PRA1 family protein A1 [Cajanus cajan] 86 2e-18 XP_019448460.1 PREDICTED: PRA1 family protein A1-like [Lupinus a... 86 3e-18 GAU49384.1 hypothetical protein TSUD_177330 [Trifolium subterran... 86 3e-18 XP_014524334.1 PREDICTED: PRA1 family protein A1-like [Vigna rad... 86 3e-18 XP_007140465.1 hypothetical protein PHAVU_008G114700g [Phaseolus... 86 3e-18 XP_004515943.1 PREDICTED: PRA1 family protein A1-like [Cicer ari... 86 3e-18 XP_003552205.1 PREDICTED: PRA1 family protein A1-like [Glycine m... 86 3e-18 NP_001237681.1 uncharacterized protein LOC100527037 [Glycine max... 86 3e-18 XP_015960625.1 PREDICTED: PRA1 family protein A1-like [Arachis d... 85 4e-18 XP_016542361.1 PREDICTED: PRA1 family protein A1-like [Capsicum ... 84 8e-18 XP_017419571.1 PREDICTED: PRA1 family protein A1-like [Vigna ang... 84 8e-18 KDO36511.1 hypothetical protein CISIN_1g031200mg [Citrus sinensis] 83 9e-18 XP_006381216.1 hypothetical protein POPTR_0006s09220g [Populus t... 83 2e-17 XP_013449007.1 PRA1 (prenylated RAB acceptor) family protein [Me... 83 2e-17 XP_006429195.1 hypothetical protein CICLE_v10012766mg [Citrus cl... 83 2e-17 AFK38488.1 unknown [Medicago truncatula] 83 2e-17 XP_015897004.1 PREDICTED: PRA1 family protein A1-like [Ziziphus ... 83 3e-17 XP_010088573.1 hypothetical protein L484_016965 [Morus notabilis... 83 3e-17 XP_011019218.1 PREDICTED: PRA1 family protein A1-like [Populus e... 83 3e-17 >ACU24194.1 unknown [Glycine max] Length = 167 Score = 85.5 bits (210), Expect = 1e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 115 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 162 >KYP45941.1 PRA1 family protein A1 [Cajanus cajan] Length = 209 Score = 86.3 bits (212), Expect = 2e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLMTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_019448460.1 PREDICTED: PRA1 family protein A1-like [Lupinus angustifolius] XP_019448463.1 PREDICTED: PRA1 family protein A1-like [Lupinus angustifolius] OIW18909.1 hypothetical protein TanjilG_25352 [Lupinus angustifolius] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >GAU49384.1 hypothetical protein TSUD_177330 [Trifolium subterraneum] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_014524334.1 PREDICTED: PRA1 family protein A1-like [Vigna radiata var. radiata] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_007140465.1 hypothetical protein PHAVU_008G114700g [Phaseolus vulgaris] ESW12459.1 hypothetical protein PHAVU_008G114700g [Phaseolus vulgaris] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_004515943.1 PREDICTED: PRA1 family protein A1-like [Cicer arietinum] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_003552205.1 PREDICTED: PRA1 family protein A1-like [Glycine max] KHN34107.1 PRA1 family protein A1 [Glycine soja] KRH00054.1 hypothetical protein GLYMA_18G188700 [Glycine max] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >NP_001237681.1 uncharacterized protein LOC100527037 [Glycine max] XP_006582872.1 PREDICTED: uncharacterized protein LOC100527037 isoform X1 [Glycine max] ACU16075.1 unknown [Glycine max] KHN05099.1 PRA1 family protein A1 [Glycine soja] KRH49188.1 hypothetical protein GLYMA_07G138300 [Glycine max] Length = 209 Score = 85.5 bits (210), Expect = 3e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_015960625.1 PREDICTED: PRA1 family protein A1-like [Arachis duranensis] XP_016198401.1 PREDICTED: PRA1 family protein A1-like [Arachis ipaensis] Length = 209 Score = 85.1 bits (209), Expect = 4e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAFGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >XP_016542361.1 PREDICTED: PRA1 family protein A1-like [Capsicum annuum] XP_016542362.1 PREDICTED: PRA1 family protein A1-like [Capsicum annuum] Length = 209 Score = 84.3 bits (207), Expect = 8e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVS GL TVL ALATGLL+T+LHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSCGLLTVLWALATGLLSTLLHASFRTPNLKARLNTFREEFRAVWR 204 >XP_017419571.1 PREDICTED: PRA1 family protein A1-like [Vigna angularis] KOM38085.1 hypothetical protein LR48_Vigan03g146700 [Vigna angularis] BAT84519.1 hypothetical protein VIGAN_04192100 [Vigna angularis var. angularis] Length = 209 Score = 84.3 bits (207), Expect = 8e-18 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL AL+ GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALSIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >KDO36511.1 hypothetical protein CISIN_1g031200mg [Citrus sinensis] Length = 164 Score = 83.2 bits (204), Expect = 9e-18 Identities = 42/48 (87%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 W+VS GL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 112 WYVSCGLLTVLWALAVGLLATILHASFRTPNLKARLNTFREEFRAVWR 159 >XP_006381216.1 hypothetical protein POPTR_0006s09220g [Populus trichocarpa] ERP59013.1 hypothetical protein POPTR_0006s09220g [Populus trichocarpa] Length = 180 Score = 82.8 bits (203), Expect = 2e-17 Identities = 42/48 (87%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 W+VS GL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 128 WYVSCGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 175 >XP_013449007.1 PRA1 (prenylated RAB acceptor) family protein [Medicago truncatula] KEH23034.1 PRA1 (prenylated RAB acceptor) family protein [Medicago truncatula] Length = 209 Score = 83.2 bits (204), Expect = 2e-17 Identities = 43/48 (89%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHAS RTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASLRTPNLKARLNTFREEFRAVWR 204 >XP_006429195.1 hypothetical protein CICLE_v10012766mg [Citrus clementina] XP_006493591.1 PREDICTED: PRA1 family protein A1-like [Citrus sinensis] ESR42435.1 hypothetical protein CICLE_v10012766mg [Citrus clementina] Length = 209 Score = 83.2 bits (204), Expect = 2e-17 Identities = 42/48 (87%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 W+VS GL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WYVSCGLLTVLWALAVGLLATILHASFRTPNLKARLNTFREEFRAVWR 204 >AFK38488.1 unknown [Medicago truncatula] Length = 209 Score = 83.2 bits (204), Expect = 2e-17 Identities = 43/48 (89%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHAS RTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASLRTPNLKARLNTFREEFRAVWR 204 >XP_015897004.1 PREDICTED: PRA1 family protein A1-like [Ziziphus jujuba] Length = 209 Score = 82.8 bits (203), Expect = 3e-17 Identities = 42/48 (87%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLAT+LHASFRTPNLKARLNTFREEFR V R Sbjct: 157 WFVSAGLLTVLWALAIGLLATLLHASFRTPNLKARLNTFREEFRQVWR 204 >XP_010088573.1 hypothetical protein L484_016965 [Morus notabilis] EXB36714.1 hypothetical protein L484_016965 [Morus notabilis] Length = 209 Score = 82.8 bits (203), Expect = 3e-17 Identities = 43/48 (89%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 WFVSAGL TVL ALA GLLATILHAS RTPNLKARLNTFREEFRAV R Sbjct: 157 WFVSAGLLTVLWALAIGLLATILHASVRTPNLKARLNTFREEFRAVWR 204 >XP_011019218.1 PREDICTED: PRA1 family protein A1-like [Populus euphratica] XP_011019219.1 PREDICTED: PRA1 family protein A1-like [Populus euphratica] XP_011019220.1 PREDICTED: PRA1 family protein A1-like [Populus euphratica] XP_011019221.1 PREDICTED: PRA1 family protein A1-like [Populus euphratica] Length = 209 Score = 82.8 bits (203), Expect = 3e-17 Identities = 42/48 (87%), Positives = 43/48 (89%) Frame = +1 Query: 1 WFVSAGLQTVLRALATGLLATILHASFRTPNLKARLNTFREEFRAVCR 144 W+VS GL TVL ALA GLLATILHASFRTPNLKARLNTFREEFRAV R Sbjct: 157 WYVSCGLLTVLWALAIGLLATILHASFRTPNLKARLNTFREEFRAVWR 204