BLASTX nr result
ID: Glycyrrhiza30_contig00005802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00005802 (738 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP44225.1 hypothetical protein KK1_034289 [Cajanus cajan] 73 1e-12 KYP67627.1 hypothetical protein KK1_023971 [Cajanus cajan] 72 5e-12 KYP32696.1 hypothetical protein KK1_046547 [Cajanus cajan] 69 4e-11 KYP36158.1 hypothetical protein KK1_042747 [Cajanus cajan] 69 7e-11 KYP52945.1 hypothetical protein KK1_025146 [Cajanus cajan] 71 8e-11 KYP72474.1 hypothetical protein KK1_005063 [Cajanus cajan] 67 2e-10 KYP66618.1 Retrovirus-related Pol polyprotein from transposon TN... 71 2e-10 KYP49182.1 hypothetical protein KK1_029117 [Cajanus cajan] 64 4e-10 KYP35620.1 hypothetical protein KK1_043331 [Cajanus cajan] 70 5e-10 KYP66597.1 Retrovirus-related Pol polyprotein from transposon TN... 69 8e-10 KYP46017.1 hypothetical protein KK1_032401 [Cajanus cajan] 68 9e-10 KYP38123.1 hypothetical protein KK1_040641 [Cajanus cajan] 63 3e-09 KYP47251.1 Retrovirus-related Pol polyprotein from transposon TN... 67 3e-09 KYP63768.1 Retrovirus-related Pol polyprotein from transposon TN... 67 3e-09 KYP62902.1 hypothetical protein KK1_017462 [Cajanus cajan] 63 3e-09 KYP40528.1 hypothetical protein KK1_038127 [Cajanus cajan] 64 4e-09 KYP75940.1 Retrovirus-related Pol polyprotein from transposon TN... 67 5e-09 KYP44960.1 Retrovirus-related Pol polyprotein from transposon TN... 67 5e-09 KYP48244.1 hypothetical protein KK1_030128, partial [Cajanus cajan] 63 5e-09 KYP44478.1 Retrovirus-related Pol polyprotein from transposon TN... 66 7e-09 >KYP44225.1 hypothetical protein KK1_034289 [Cajanus cajan] Length = 150 Score = 73.2 bits (178), Expect = 1e-12 Identities = 34/59 (57%), Positives = 44/59 (74%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEE 561 +GIKKT +I +YLL IKKIVDTLAA+GSP+ T + I+AIF+GLP +YDP + E Sbjct: 42 RGIKKTTAINQYLLEIKKIVDTLAAIGSPLDTTEHIDAIFDGLPEEYDPFVTSVLTRTE 100 >KYP67627.1 hypothetical protein KK1_023971 [Cajanus cajan] Length = 189 Score = 72.4 bits (176), Expect = 5e-12 Identities = 38/81 (46%), Positives = 53/81 (65%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEEL 558 +GIKKT +I +YLL IKKIVDTLA +GSP+ T + I+AIF+GLP +YDP TF L + Sbjct: 42 RGIKKTTAINQYLLEIKKIVDTLATIGSPLDTTEHIDAIFDGLPEEYDPFV--TFVLIRI 99 Query: 557 WGYRLPTNQSQRSPKDEGLRR 495 Y + ++ +E L + Sbjct: 100 EDYTVEQIEALLMAHEERLEK 120 >KYP32696.1 hypothetical protein KK1_046547 [Cajanus cajan] Length = 161 Score = 69.3 bits (168), Expect = 4e-11 Identities = 30/52 (57%), Positives = 43/52 (82%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFS 582 + IKK+ ++ +YLL IKKIVDTLAA+GSP++T + I+AIF+GLP +YDP + Sbjct: 42 RSIKKSTAVNQYLLEIKKIVDTLAAIGSPLNTAEHIDAIFDGLPEEYDPFIT 93 >KYP36158.1 hypothetical protein KK1_042747 [Cajanus cajan] Length = 190 Score = 69.3 bits (168), Expect = 7e-11 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEE 561 +GIKKT +I +YLL IKKIVDTLA +GSP+ T + I+ IF+GLP +YDP + E Sbjct: 131 RGIKKTIAINQYLLEIKKIVDTLAVIGSPLDTTEHIDTIFDGLPEEYDPFVTSVLTRTE 189 >KYP52945.1 hypothetical protein KK1_025146 [Cajanus cajan] Length = 287 Score = 70.9 bits (172), Expect = 8e-11 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKTGSI EYL+ +K+IV+TLAA+GSP+S ED I+AIF+GL DYD Sbjct: 101 RNIKKTGSIAEYLVQVKQIVETLAAIGSPLSVEDHIDAIFDGLDEDYD 148 >KYP72474.1 hypothetical protein KK1_005063 [Cajanus cajan] Length = 125 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = -2 Query: 731 IKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEE 561 IKK+ +I YLL IKKIVDTLA +GSP+ T + I+AIF+GLP +YDP + E Sbjct: 27 IKKSTTINHYLLEIKKIVDTLAVIGSPLDTTEHIDAIFDGLPEEYDPFITSVLTRTE 83 >KYP66618.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 660 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKTGSI EYL+ +K+IV+TLAA+GSP+S ED I+AIF+GL DYD Sbjct: 550 RNIKKTGSIAEYLVQVKQIVETLAAIGSPLSVEDHIDAIFDGLDEDYD 597 >KYP49182.1 hypothetical protein KK1_029117 [Cajanus cajan] Length = 50 Score = 63.5 bits (153), Expect = 4e-10 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -2 Query: 716 SITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFS 582 +I +YLL IKKIVDTLAA+GSP++T + I+AIF+GLP +YDP + Sbjct: 2 TINQYLLEIKKIVDTLAAIGSPLNTVEHIDAIFDGLPKEYDPFIT 46 >KYP35620.1 hypothetical protein KK1_043331 [Cajanus cajan] Length = 589 Score = 69.7 bits (169), Expect = 5e-10 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKTGSI EYL+ +K+IV+TLAA+G+P+S ED I+AIF+GL DYD Sbjct: 101 RNIKKTGSIAEYLVQVKQIVETLAAIGAPLSVEDHIDAIFDGLDEDYD 148 >KYP66597.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 562 Score = 68.9 bits (167), Expect = 8e-10 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKTGSI EYL+ +K+IV+TLAA+GSP+S ED I+AIF+GL +YD Sbjct: 101 RNIKKTGSIAEYLVQVKQIVETLAAIGSPLSVEDHIDAIFDGLDENYD 148 >KYP46017.1 hypothetical protein KK1_032401 [Cajanus cajan] Length = 334 Score = 68.2 bits (165), Expect = 9e-10 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKTGSI EYL+ +K+IV+TL A+G+P+S ED I+AIF+GL DYD Sbjct: 130 RNIKKTGSIAEYLVQVKQIVETLVAIGAPLSVEDHIDAIFDGLDEDYD 177 >KYP38123.1 hypothetical protein KK1_040641 [Cajanus cajan] Length = 112 Score = 63.2 bits (152), Expect = 3e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPL 588 KGIKK+ S++EYLL IKKIVDTLA V SPI + + I I GLPS+Y+PL Sbjct: 4 KGIKKSTSLSEYLLSIKKIVDTLAFVDSPIDSFEHISIILVGLPSEYNPL 53 >KYP47251.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 536 Score = 67.4 bits (163), Expect = 3e-09 Identities = 34/85 (40%), Positives = 54/85 (63%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEEL 558 + + KTG ++ YLL IK++ +TLAA+GSP+S E+ I+ IF+GLP +YDPL + E Sbjct: 46 RNVCKTGPMSHYLLQIKQLTETLAAIGSPVSLEEHIDFIFDGLPEEYDPLETSCLTRSE- 104 Query: 557 WGYRLPTNQSQRSPKDEGLRRTEMK 483 Y +P ++ ++E L R + K Sbjct: 105 -PYTVPEIEALLLHQEERLERRKQK 128 >KYP63768.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 678 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEE 561 KGIKK+ S+ EYLL IKKIVDTLA VGSPI + + I I +GLPS+Y+P + + + Sbjct: 23 KGIKKSTSLNEYLLSIKKIVDTLAYVGSPIDSSEHISIILDGLPSEYNPFVTSIISITD 81 >KYP62902.1 hypothetical protein KK1_017462 [Cajanus cajan] Length = 120 Score = 63.2 bits (152), Expect = 3e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKT SIT YLL IKK+VDTLA +G+P++ E+ +AI +GLP +YD Sbjct: 42 RSIKKTSSITLYLLEIKKVVDTLAVIGAPLNVEEHFDAIVDGLPDEYD 89 >KYP40528.1 hypothetical protein KK1_038127 [Cajanus cajan] Length = 173 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPL 588 KGIKK S+ YLL IKKI+DTLA++GS + + I+ I NGLPS+Y+PL Sbjct: 79 KGIKKQDSLNSYLLAIKKIIDTLASIGSLVDPREHIQIILNGLPSEYNPL 128 >KYP75940.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1403 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPLFSGTFKLEE 561 +GIKKT +I +YLL IKKIV+ LAA+GSP++T + I+AIF+GL +YDP + E Sbjct: 133 RGIKKTTAINQYLLEIKKIVNNLAAIGSPLNTAEHIDAIFDGLSEEYDPFITSVLTRTE 191 >KYP44960.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 517 Score = 66.6 bits (161), Expect = 5e-09 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 731 IKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 IKK SI+EYLL IKKIVD+LAA+GS IS +D IEAI +GLP DYD Sbjct: 135 IKKDKSISEYLLAIKKIVDSLAAIGSAISDDDHIEAILDGLPEDYD 180 >KYP48244.1 hypothetical protein KK1_030128, partial [Cajanus cajan] Length = 138 Score = 63.2 bits (152), Expect = 5e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYD 594 + IKKT SIT YLL IKK+VDTLA +G+P++ E+ +AI +GLP +YD Sbjct: 60 RSIKKTSSITLYLLEIKKVVDTLAVIGAPLNVEEHFDAIVDGLPDEYD 107 >KYP44478.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 605 Score = 66.2 bits (160), Expect = 7e-09 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -2 Query: 737 KGIKKTGSITEYLLLIKKIVDTLAAVGSPISTEDQIEAIFNGLPSDYDPL 588 KGIKK S+ YLL IKKI+DTLA+VGSP+ + I+ I +GLPS+Y+PL Sbjct: 79 KGIKKQDSLNSYLLAIKKIIDTLASVGSPVDPAEHIQIILDGLPSEYNPL 128