BLASTX nr result
ID: Glycyrrhiza30_contig00005535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00005535 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW55427.1 hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] 56 4e-07 OMP05967.1 hypothetical protein COLO4_08423 [Corchorus olitorius] 57 2e-06 >KCW55427.1 hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] Length = 121 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = -2 Query: 258 FGRAFPYDPLNLFPFFVFLSPRPHNIGPATPPHSAAAIDDDGG 130 FGRAFPYDPLNLFPFFV LSP PH G +A A D D G Sbjct: 28 FGRAFPYDPLNLFPFFVRLSPLPHRTGSG---GAAPAADGDAG 67 >OMP05967.1 hypothetical protein COLO4_08423 [Corchorus olitorius] Length = 840 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/80 (42%), Positives = 44/80 (55%), Gaps = 5/80 (6%) Frame = -2 Query: 255 GRAFPYDPLNLFPFFVFLSPRPHNIGP--ATPPHSAAAIDDDGGPLVNHLAATLLHRC-- 88 G FPYDPLN FPFFVFLSP PH IG A P A + + P++ L AT H C Sbjct: 29 GLVFPYDPLNHFPFFVFLSPLPHRIGARIAAVPLGEADVREGHWPVIT-LFATAPHHCII 87 Query: 87 -ITFTLTPLAIPIHTSTLRF 31 I+F L P++ ++ + Sbjct: 88 AISFFEFSLTFPLNCHSISY 107