BLASTX nr result
ID: Glycyrrhiza30_contig00005260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00005260 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23484.1 hypothetical protein TSUD_81660 [Trifolium subterraneum] 60 4e-09 XP_003550271.1 PREDICTED: uncharacterized protein LOC100778066 [... 59 1e-08 XP_004498897.1 PREDICTED: DNA topoisomerase 1-like [Cicer arieti... 58 3e-08 XP_003589004.1 hypothetical protein MTR_1g016270 [Medicago trunc... 54 8e-07 XP_004513690.1 PREDICTED: WD repeat-containing protein 87-like [... 53 1e-06 >GAU23484.1 hypothetical protein TSUD_81660 [Trifolium subterraneum] Length = 326 Score = 60.5 bits (145), Expect = 4e-09 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 6/52 (11%) Frame = -3 Query: 209 KKKHREGTE------EVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEG 72 KKKH+ G E EV E+RKKRK +D+E + E+RSG+ +KK+MKRKHEG Sbjct: 275 KKKHKAGAESKLDGEEVSTEKRKKRKNQDLEEKSEERSGERSKKKMKRKHEG 326 >XP_003550271.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] XP_006601233.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] XP_006601234.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] XP_006601235.1 PREDICTED: uncharacterized protein LOC100778066 [Glycine max] KHN37031.1 hypothetical protein glysoja_009059 [Glycine soja] KRH05461.1 hypothetical protein GLYMA_17G228900 [Glycine max] KRH05462.1 hypothetical protein GLYMA_17G228900 [Glycine max] KRH05463.1 hypothetical protein GLYMA_17G228900 [Glycine max] KRH05464.1 hypothetical protein GLYMA_17G228900 [Glycine max] Length = 315 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/53 (50%), Positives = 39/53 (73%), Gaps = 6/53 (11%) Frame = -3 Query: 209 KKKHREGTE------EVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEGN 69 KKK+++G+E EVK+EQ K R+ +D EGRPED +GDL+KK+ K+ H G+ Sbjct: 262 KKKYKKGSETKLYAEEVKLEQSKNRRSDDAEGRPEDPTGDLSKKKRKKTHNGD 314 >XP_004498897.1 PREDICTED: DNA topoisomerase 1-like [Cicer arietinum] Length = 315 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/53 (52%), Positives = 40/53 (75%), Gaps = 6/53 (11%) Frame = -3 Query: 209 KKKHREGTE------EVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEGN 69 KK++ G+E EVK +Q+KK+ +++E R EDRSG+L+KKRMKRKHEG+ Sbjct: 262 KKRYEAGSENKLNAEEVKTDQKKKKMNKNVEERSEDRSGELSKKRMKRKHEGH 314 >XP_003589004.1 hypothetical protein MTR_1g016270 [Medicago truncatula] AES59255.1 hypothetical protein MTR_1g016270 [Medicago truncatula] AFK39249.1 unknown [Medicago truncatula] Length = 276 Score = 53.9 bits (128), Expect = 8e-07 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 6/52 (11%) Frame = -3 Query: 209 KKKHREGTE------EVKMEQRKKRKKEDMEGRPEDRSGDLTKKRMKRKHEG 72 KKKH G+E E K EQRKKRK ED E +RSG+ +KK+MKRKHEG Sbjct: 229 KKKHEAGSENKLHAGEEKTEQRKKRKNEDAE----ERSGEKSKKKMKRKHEG 276 >XP_004513690.1 PREDICTED: WD repeat-containing protein 87-like [Cicer arietinum] Length = 274 Score = 53.1 bits (126), Expect = 1e-06 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 9/54 (16%) Frame = -3 Query: 209 KKKHREGTE------EVKMEQRKKRKKEDMEG---RPEDRSGDLTKKRMKRKHE 75 KK++ G+E EVKMEQ+KK+KK+ EG R EDRSG+ +KKRMK KHE Sbjct: 218 KKRYELGSENKLNPEEVKMEQKKKKKKKKNEGVEERSEDRSGEHSKKRMKMKHE 271