BLASTX nr result
ID: Glycyrrhiza30_contig00004725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00004725 (619 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CBI39675.3 unnamed protein product, partial [Vitis vinifera] 82 6e-17 AFK48113.1 unknown [Medicago truncatula] 80 2e-16 XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [... 82 9e-16 XP_018722406.1 PREDICTED: uncharacterized protein LOC104429784 [... 76 6e-13 KRG96664.1 hypothetical protein GLYMA_19G224800 [Glycine max] 58 9e-08 XP_003626135.2 low temperature and salt responsive family protei... 57 1e-07 XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachi... 56 1e-07 KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] 55 3e-07 XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bre... 54 1e-06 XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus ... 54 1e-06 XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domes... 54 1e-06 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 54 1e-06 KMZ61773.1 Low temperature and salt responsive protein [Zostera ... 53 3e-06 GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterran... 53 3e-06 XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radia... 53 3e-06 XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nuc... 53 3e-06 XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglan... 52 4e-06 XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus ... 52 4e-06 XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis... 52 4e-06 XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium r... 52 6e-06 >CBI39675.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 82.4 bits (202), Expect = 6e-17 Identities = 39/64 (60%), Positives = 44/64 (68%) Frame = +2 Query: 32 KRERENGKGRHSYLYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCH 211 K ENG S+L+RH HH + WCLPQVW+P GVLDLFGA F + SWN LC LCH Sbjct: 38 KTREENG----SHLHRHSLGHHLAPPWCLPQVWMPGGVLDLFGADFFRLPSWNCLCCLCH 93 Query: 212 HQVI 223 HQVI Sbjct: 94 HQVI 97 >AFK48113.1 unknown [Medicago truncatula] Length = 59 Score = 79.7 bits (195), Expect = 2e-16 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +2 Query: 71 LYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI*LPLIN 241 ++R+ HHP S+ CLPQVWLP GVL LFG +PFW+ WN LCYLC++QVI L ++ Sbjct: 1 MHRYHCCHHPPSSRCLPQVWLPCGVLALFGTNPFWLSPWNSLCYLCYYQVINLAFVD 57 >XP_009365457.1 PREDICTED: uncharacterized protein LOC103955308 [Pyrus x bretschneideri] Length = 211 Score = 82.0 bits (201), Expect = 9e-16 Identities = 38/72 (52%), Positives = 49/72 (68%) Frame = +2 Query: 59 RHSYLYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCHHQVI*LPLI 238 R+ L RHPPRH +S+W LPQVWLP G+LDLF A W++ W++LC+LCHHQV + Sbjct: 122 RNIKLRRHPPRHPLASSWRLPQVWLPCGILDLFVADLIWLHPWDYLCHLCHHQV----MS 177 Query: 239 NFASVDNE*LYV 274 NF D + YV Sbjct: 178 NFCIRDAKDTYV 189 >XP_018722406.1 PREDICTED: uncharacterized protein LOC104429784 [Eucalyptus grandis] Length = 339 Score = 76.3 bits (186), Expect = 6e-13 Identities = 36/63 (57%), Positives = 44/63 (69%) Frame = +2 Query: 32 KRERENGKGRHSYLYRHPPRHHPSSTWCLPQVWLPRGVLDLFGAHPFWVYSWNHLCYLCH 211 +R R+NG H L+RHPP HH +S+ LPQVWLP GVLDL AH + S HLC+LCH Sbjct: 234 ERNRKNGGRGHDELHRHPPSHHLASSRGLPQVWLPGGVLDLCVAHYLRLDSRYHLCHLCH 293 Query: 212 HQV 220 +QV Sbjct: 294 YQV 296 >KRG96664.1 hypothetical protein GLYMA_19G224800 [Glycine max] Length = 107 Score = 58.2 bits (139), Expect = 9e-08 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 5/47 (10%) Frame = +2 Query: 98 PSSTWCLPQVWL-----PRGVLDLFGAHPFWVYSWNHLCYLCHHQVI 223 P+ST LP +L +LDLFGA+PFW++SWN+LC LC+HQVI Sbjct: 44 PASTSSLPSSFLLLVSSSSRILDLFGAYPFWLHSWNYLCCLCYHQVI 90 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 56.6 bits (135), Expect = 1e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFLKFGCHVEFW+CLVLTLF Sbjct: 2 GTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLF 39 >XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis duranensis] XP_016205642.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis ipaensis] Length = 56 Score = 56.2 bits (134), Expect = 1e-07 Identities = 25/38 (65%), Positives = 26/38 (68%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFLK+GCHVEFWICLVLTLF Sbjct: 4 GTATCIDILLAIILPPLGVFLKYGCHVEFWICLVLTLF 41 >KHN43377.1 hypothetical protein glysoja_001960 [Glycine soja] Length = 57 Score = 55.5 bits (132), Expect = 3e-07 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = +2 Query: 143 VLDLFGAHPFWVYSWNHLCYLCHHQVI 223 +LDLFGA+PFW++SWN+LC LC+HQVI Sbjct: 14 ILDLFGAYPFWLHSWNYLCCLCYHQVI 40 >XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] XP_009366022.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] Length = 54 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505092.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505094.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] XP_008345581.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFL+FGCH EFWICLVLTLF Sbjct: 2 GTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF 39 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTA C GVFLKFGCHVEFWICLVLT F Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFF 42 >KMZ61773.1 Low temperature and salt responsive protein [Zostera marina] Length = 54 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GT C GVFLKFGCHVEFWICL+LTLF Sbjct: 2 GTTNCIDILVAIFLPPIGVFLKFGCHVEFWICLLLTLF 39 >GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterraneum] Length = 57 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTA C GVFLKFGC+VEFWICLVLTLF Sbjct: 5 GTANCIDILLAIILPPLGVFLKFGCNVEFWICLVLTLF 42 >XP_014511134.1 PREDICTED: hydrophobic protein RCI2B [Vigna radiata var. radiata] XP_017413861.1 PREDICTED: hydrophobic protein RCI2B [Vigna angularis] KOM35416.1 hypothetical protein LR48_Vigan02g156600 [Vigna angularis] Length = 57 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFLK+GC VEFWICLVLTLF Sbjct: 5 GTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLF 42 >XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFLKFGC VEFWICL+LTLF Sbjct: 5 GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLF 42 >XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglans regia] Length = 57 Score = 52.4 bits (124), Expect = 4e-06 Identities = 23/38 (60%), Positives = 25/38 (65%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GTATC GVFLKFGC VEFWICL+LT+F Sbjct: 5 GTATCIDILLAIILPPLGVFLKFGCQVEFWICLLLTIF 42 >XP_009335544.1 PREDICTED: hydrophobic protein LTI6B-like [Pyrus x bretschneideri] Length = 57 Score = 52.4 bits (124), Expect = 4e-06 Identities = 23/38 (60%), Positives = 24/38 (63%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GT C GVFLKFGCHVEFWICL+LTLF Sbjct: 5 GTLNCVDILLAILLPPLGVFLKFGCHVEFWICLLLTLF 42 >XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis guineensis] Length = 59 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/38 (63%), Positives = 24/38 (63%) Frame = +3 Query: 60 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 GT TC GVFLKFGC VEFWICLVLTLF Sbjct: 5 GTVTCIDILIAIILPPLGVFLKFGCKVEFWICLVLTLF 42 >XP_012464989.1 PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] XP_016667936.1 PREDICTED: hydrophobic protein RCI2B [Gossypium hirsutum] KJB82717.1 hypothetical protein B456_013G210800 [Gossypium raimondii] KJB82718.1 hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/37 (64%), Positives = 24/37 (64%) Frame = +3 Query: 63 TATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLF 173 TATC GVFLKFGC VEFWICLVLTLF Sbjct: 6 TATCVDILLAIILPPLGVFLKFGCQVEFWICLVLTLF 42