BLASTX nr result
ID: Glycyrrhiza30_contig00004712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00004712 (773 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN09212.1 hypothetical protein glysoja_036440 [Glycine soja] 66 1e-10 KOM43769.1 hypothetical protein LR48_Vigan05g137400 [Vigna angul... 53 5e-06 >KHN09212.1 hypothetical protein glysoja_036440 [Glycine soja] Length = 76 Score = 65.9 bits (159), Expect = 1e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 448 VVADMHMPLLLVPDSNCGACVGVDKGSTACHGVVH 552 +VADMHMPLLLVPD N GACV + +GSTACHGVVH Sbjct: 33 IVADMHMPLLLVPDRNSGACVSIGEGSTACHGVVH 67 >KOM43769.1 hypothetical protein LR48_Vigan05g137400 [Vigna angularis] Length = 83 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 448 VVADMHMPLLLVPDSNCGACVGVDKGSTACHGVVH 552 VV DMHMPLLLV + + G +G+ KGST CHGVVH Sbjct: 32 VVVDMHMPLLLVYNGHSGVGIGIGKGSTPCHGVVH 66 Score = 26.2 bits (56), Expect(2) = 5e-06 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 338 MCNSDGDCR 364 MCNSDGDCR Sbjct: 1 MCNSDGDCR 9