BLASTX nr result
ID: Glycyrrhiza30_contig00004444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00004444 (204 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEW79284.1 cell wall-associated hydrolase [Brucella abortus NCTC... 99 4e-25 EEW89200.1 cell wall-associated hydrolase [Brucella suis bv. 4 s... 97 2e-24 EEW79283.1 conserved hypothetical protein [Brucella abortus NCTC... 91 1e-22 SDP92290.1 hypothetical protein SAMN05443582_1226 [Phyllobacteri... 91 1e-22 EAS50137.1 conserved hypothetical protein [Aurantimonas manganox... 91 1e-21 ADI18733.1 hypothetical protein [uncultured Rhizobiales bacteriu... 85 8e-20 EMS40254.1 Hypothetical protein MmSR116_4659 [Methylobacterium m... 83 1e-18 EXT24590.1 hypothetical protein J785_3641, partial [Acinetobacte... 79 2e-18 EXI18533.1 hypothetical protein J634_3950, partial [Acinetobacte... 79 2e-18 EXG41297.1 hypothetical protein J735_4187, partial [Acinetobacte... 79 2e-18 EXE47713.1 hypothetical protein J571_0594, partial [Acinetobacte... 79 2e-18 EXV31665.1 hypothetical protein J843_3846, partial [Acinetobacte... 79 2e-18 EYS19136.1 hypothetical protein J972_4153, partial [Acinetobacte... 79 3e-18 XP_003088200.1 hypothetical protein CRE_03576 [Caenorhabditis re... 81 3e-18 EXI47625.1 hypothetical protein J648_3462, partial [Acinetobacte... 79 3e-18 EXT63604.1 hypothetical protein J771_4023, partial [Acinetobacte... 79 3e-18 EYS73392.1 hypothetical protein J997_3937, partial [Acinetobacte... 79 3e-18 EXH63948.1 hypothetical protein J617_3565, partial [Acinetobacte... 79 3e-18 EXR01208.1 hypothetical protein J676_2301, partial [Acinetobacte... 79 3e-18 EXI47652.1 hypothetical protein J645_3982, partial [Acinetobacte... 79 3e-18 >EEW79284.1 cell wall-associated hydrolase [Brucella abortus NCTC 8038] EEW86125.1 cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] EEX91415.1 cell wall-associated hydrolase [Brucella ceti M13/05/1] EEX98833.1 cell wall-associated hydrolase [Brucella ceti M644/93/1] EEX98865.1 cell wall-associated hydrolase [Brucella pinnipedialis B2/94] EEY06499.1 cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] EEZ07328.1 cell wall-associated hydrolase [Brucella ceti M490/95/1] EEZ33513.1 cell wall-associated hydrolase [Brucella sp. 83/13] Length = 152 Score = 99.4 bits (246), Expect = 4e-25 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 MPSAVIPS +SYPAMRLAPQQVHQRYVHPGPLVLGTDP NIPTPTADRD Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTPTADRD 49 >EEW89200.1 cell wall-associated hydrolase [Brucella suis bv. 4 str. 40] Length = 152 Score = 97.4 bits (241), Expect = 2e-24 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 MPSAVIPS +SYPAMRLAPQQVHQRYVHPGPLVLGTDP NIPTPTADR+ Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTPTADRN 49 >EEW79283.1 conserved hypothetical protein [Brucella abortus NCTC 8038] EEW89201.1 conserved hypothetical protein [Brucella suis bv. 4 str. 40] EEX91416.1 conserved hypothetical protein [Brucella ceti M13/05/1] EEX98834.1 conserved hypothetical protein [Brucella ceti M644/93/1] EEX98864.1 conserved hypothetical protein [Brucella pinnipedialis B2/94] EEY06500.1 conserved hypothetical protein [Brucella pinnipedialis M163/99/10] EEZ33512.1 conserved hypothetical protein [Brucella sp. 83/13] Length = 80 Score = 90.9 bits (224), Expect = 1e-22 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 182 GNTRFKVGFPLRCLQRLSRPDIATLLCGWRHNRSTRGTSIPVLSY 48 GNTRF+VGFPLRCLQRLSRP IATLLCGWRHNRSTR TSIPVLSY Sbjct: 36 GNTRFQVGFPLRCLQRLSRPYIATLLCGWRHNRSTRDTSIPVLSY 80 >SDP92290.1 hypothetical protein SAMN05443582_1226 [Phyllobacterium sp. OV277] Length = 84 Score = 90.9 bits (224), Expect = 1e-22 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 182 GNTRFKVGFPLRCLQRLSRPDIATLLCGWRHNRSTRGTSIPVLSY 48 GNTRF+VGFPLRCLQRLSRP IATLLCGWRHNRSTR TSIPVLSY Sbjct: 40 GNTRFQVGFPLRCLQRLSRPYIATLLCGWRHNRSTRDTSIPVLSY 84 >EAS50137.1 conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1] Length = 152 Score = 90.5 bits (223), Expect = 1e-21 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 MPSAVIP+ HSYPA+RLAPQQVHQRYV PGPLVLG+DP N P PTADRD Sbjct: 1 MPSAVIPTVHSYPALRLAPQQVHQRYVQPGPLVLGSDPVNSPAPTADRD 49 >ADI18733.1 hypothetical protein [uncultured Rhizobiales bacterium HF4000_32B18] Length = 125 Score = 85.1 bits (209), Expect = 8e-20 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 182 GNTRFKVGFPLRCLQRLSRPDIATLLCGWRHNRSTRGTSIPVLSY 48 G TRF+VGFPLRC QRLSRP +ATL CGWRHNRSTRGTS PVLSY Sbjct: 81 GRTRFQVGFPLRCFQRLSRPYVATLQCGWRHNRSTRGTSTPVLSY 125 >EMS40254.1 Hypothetical protein MmSR116_4659 [Methylobacterium mesophilicum SR1.6/6] Length = 152 Score = 82.8 bits (203), Expect = 1e-18 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 MPSAVIPS HSY A+ LA QQ+HQRYVHPGPLVLGT P PTPTADRD Sbjct: 1 MPSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGTKPLKPPTPTADRD 49 >EXT24590.1 hypothetical protein J785_3641, partial [Acinetobacter baumannii 44895_2] EXT25229.1 hypothetical protein J785_3295, partial [Acinetobacter baumannii 44895_2] EXT26777.1 hypothetical protein J785_2181, partial [Acinetobacter baumannii 44895_2] EXU34277.1 hypothetical protein J758_3967, partial [Acinetobacter baumannii 24845_5] EXU35328.1 hypothetical protein J758_3712, partial [Acinetobacter baumannii 24845_5] EXU35881.1 hypothetical protein J758_3519, partial [Acinetobacter baumannii 24845_5] EXU38240.1 hypothetical protein J758_2568, partial [Acinetobacter baumannii 24845_5] EXU39435.1 hypothetical protein J758_1553, partial [Acinetobacter baumannii 24845_5] Length = 49 Score = 79.3 bits (194), Expect = 2e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXI18533.1 hypothetical protein J634_3950, partial [Acinetobacter baumannii 737393] EXI20656.1 hypothetical protein J634_3607, partial [Acinetobacter baumannii 737393] EXI21853.1 hypothetical protein J634_3217, partial [Acinetobacter baumannii 737393] EXI24514.1 hypothetical protein J634_1421, partial [Acinetobacter baumannii 737393] EXU44754.1 hypothetical protein J756_3948, partial [Acinetobacter baumannii 24845_3] EXU46180.1 hypothetical protein J756_3651, partial [Acinetobacter baumannii 24845_3] EXV18201.1 hypothetical protein J852_3980, partial [Acinetobacter baumannii 24975_9] EXV19306.1 hypothetical protein J852_3846, partial [Acinetobacter baumannii 24975_9] EXV19644.1 hypothetical protein J852_3624, partial [Acinetobacter baumannii 24975_9] EXV21390.1 hypothetical protein J852_2656, partial [Acinetobacter baumannii 24975_9] EXV22043.1 hypothetical protein J852_2135, partial [Acinetobacter baumannii 24975_9] EXV27106.1 hypothetical protein J847_3848, partial [Acinetobacter baumannii 24975_4] EXV27451.1 hypothetical protein J847_3564, partial [Acinetobacter baumannii 24975_4] EXV27618.1 hypothetical protein J847_3353, partial [Acinetobacter baumannii 24975_4] EXV28999.1 hypothetical protein J847_1958, partial [Acinetobacter baumannii 24975_4] EZI90649.1 hypothetical protein J977_3603, partial [Acinetobacter baumannii 44298_1] EZI96275.1 hypothetical protein J977_1113, partial [Acinetobacter baumannii 44298_1] EZJ12131.1 hypothetical protein J734_3584, partial [Acinetobacter baumannii 24860_1] EZJ12515.1 hypothetical protein J734_3456, partial [Acinetobacter baumannii 24860_1] EZJ15937.1 hypothetical protein J734_2343, partial [Acinetobacter baumannii 24860_1] EZJ17004.1 hypothetical protein J734_1625, partial [Acinetobacter baumannii 24860_1] KCX27395.1 hypothetical protein J467_3582, partial [Acinetobacter baumannii 916567] Length = 51 Score = 79.3 bits (194), Expect = 2e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXG41297.1 hypothetical protein J735_4187, partial [Acinetobacter baumannii 24860_2] EXH62558.1 hypothetical protein J615_3534, partial [Acinetobacter baumannii 1482820] EXH62594.1 hypothetical protein J615_3506, partial [Acinetobacter baumannii 1482820] Length = 52 Score = 79.3 bits (194), Expect = 2e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXE47713.1 hypothetical protein J571_0594, partial [Acinetobacter baumannii 554515] Length = 53 Score = 79.3 bits (194), Expect = 2e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXV31665.1 hypothetical protein J843_3846, partial [Acinetobacter baumannii 25935_10] EXV34157.1 hypothetical protein J843_2254, partial [Acinetobacter baumannii 25935_10] EXV34793.1 hypothetical protein J843_1848, partial [Acinetobacter baumannii 25935_10] EXV35167.1 hypothetical protein J843_1621, partial [Acinetobacter baumannii 25935_10] EXW16055.1 hypothetical protein J816_3969, partial [Acinetobacter baumannii 25766_3] EXW23344.1 hypothetical protein J816_1332, partial [Acinetobacter baumannii 25766_3] EYS07183.1 hypothetical protein K012_2053, partial [Acinetobacter baumannii 25569_6] EYS07610.1 hypothetical protein K012_1554, partial [Acinetobacter baumannii 25569_6] KCW23495.1 hypothetical protein J724_3687, partial [Acinetobacter baumannii 1064293_46] Length = 53 Score = 79.3 bits (194), Expect = 2e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EYS19136.1 hypothetical protein J972_4153, partial [Acinetobacter baumannii 26016_6] EYS20796.1 hypothetical protein J972_3993, partial [Acinetobacter baumannii 26016_6] EYS21492.1 hypothetical protein J972_3541, partial [Acinetobacter baumannii 26016_6] EYS24304.1 hypothetical protein J972_2083, partial [Acinetobacter baumannii 26016_6] EYS24799.1 hypothetical protein J972_1763, partial [Acinetobacter baumannii 26016_6] Length = 55 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >XP_003088200.1 hypothetical protein CRE_03576 [Caenorhabditis remanei] EFO92753.1 hypothetical protein CRE_03576 [Caenorhabditis remanei] Length = 122 Score = 81.3 bits (199), Expect = 3e-18 Identities = 38/49 (77%), Positives = 39/49 (79%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP PTPT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPTPTVDRD 49 >EXI47625.1 hypothetical protein J648_3462, partial [Acinetobacter baumannii 10519] EXI49032.1 hypothetical protein J648_3121, partial [Acinetobacter baumannii 10519] Length = 56 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXT63604.1 hypothetical protein J771_4023, partial [Acinetobacter baumannii 25307_8] EXT64884.1 hypothetical protein J771_3839, partial [Acinetobacter baumannii 25307_8] EXT64935.1 hypothetical protein J771_3820, partial [Acinetobacter baumannii 25307_8] EXT67883.1 hypothetical protein J771_2081, partial [Acinetobacter baumannii 25307_8] EXT68884.1 hypothetical protein J771_1649, partial [Acinetobacter baumannii 25307_8] EXT68987.1 hypothetical protein J771_1422, partial [Acinetobacter baumannii 25307_8] EXW41239.1 hypothetical protein J903_3637, partial [Acinetobacter baumannii 44857_10] EXW42805.1 hypothetical protein J903_3203, partial [Acinetobacter baumannii 44857_10] EXW45415.1 hypothetical protein J903_1558, partial [Acinetobacter baumannii 44857_10] KCX22583.1 hypothetical protein J501_4490, partial [Acinetobacter baumannii 96512] Length = 57 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EYS73392.1 hypothetical protein J997_3937, partial [Acinetobacter baumannii 16553_1] EYS74080.1 hypothetical protein J997_3762, partial [Acinetobacter baumannii 16553_1] EYS74756.1 hypothetical protein J997_3604, partial [Acinetobacter baumannii 16553_1] EYS75465.1 hypothetical protein J997_3484, partial [Acinetobacter baumannii 16553_1] EYS79418.1 hypothetical protein J997_2540, partial [Acinetobacter baumannii 16553_1] KCX34227.1 hypothetical protein J577_3174, partial [Acinetobacter sp. 263903-1] KCX34765.1 hypothetical protein J577_3110, partial [Acinetobacter sp. 263903-1] KCX36248.1 hypothetical protein J577_2518, partial [Acinetobacter sp. 263903-1] KCX36502.1 hypothetical protein J577_2311, partial [Acinetobacter sp. 263903-1] KCX37030.1 hypothetical protein J577_2061, partial [Acinetobacter sp. 263903-1] KCX37681.1 hypothetical protein J577_1308, partial [Acinetobacter sp. 263903-1] Length = 58 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXH63948.1 hypothetical protein J617_3565, partial [Acinetobacter baumannii 1475764] EXH64854.1 hypothetical protein J617_3356, partial [Acinetobacter baumannii 1475764] EXH66140.1 hypothetical protein J617_3149, partial [Acinetobacter baumannii 1475764] EXH73204.1 hypothetical protein J617_0341, partial [Acinetobacter baumannii 1475764] EXT66841.1 hypothetical protein J769_3824, partial [Acinetobacter baumannii 25307_6] EXT69609.1 hypothetical protein J769_3385, partial [Acinetobacter baumannii 25307_6] EXT72361.1 hypothetical protein J769_2591, partial [Acinetobacter baumannii 25307_6] EXT73563.1 hypothetical protein J769_1988, partial [Acinetobacter baumannii 25307_6] EXW04704.1 hypothetical protein J819_3991, partial [Acinetobacter baumannii 25766_6] EXW06398.1 hypothetical protein J819_3601, partial [Acinetobacter baumannii 25766_6] EXW06901.1 hypothetical protein J819_3362, partial [Acinetobacter baumannii 25766_6] EXW09402.1 hypothetical protein J819_2188, partial [Acinetobacter baumannii 25766_6] EXW10226.1 hypothetical protein J819_1975, partial [Acinetobacter baumannii 25766_6] EYD14000.1 hypothetical protein J943_3510, partial [Acinetobacter baumannii 44362_10] EYD17171.1 hypothetical protein J943_1779, partial [Acinetobacter baumannii 44362_10] EYD17865.1 hypothetical protein J943_1194, partial [Acinetobacter baumannii 44362_10] Length = 59 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXR01208.1 hypothetical protein J676_2301, partial [Acinetobacter baumannii 1262761-97] EXV07999.1 hypothetical protein J855_3630, partial [Acinetobacter baumannii 25561_2] EXV11975.1 hypothetical protein J855_1600, partial [Acinetobacter baumannii 25561_2] KCV84934.1 hypothetical protein J979_3542, partial [Acinetobacter baumannii 44298_3] KCV88892.1 hypothetical protein J979_1756, partial [Acinetobacter baumannii 44298_3] KCV90007.1 hypothetical protein J979_1228, partial [Acinetobacter baumannii 44298_3] KCV90607.1 hypothetical protein J979_1013, partial [Acinetobacter baumannii 44298_3] Length = 61 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49 >EXI47652.1 hypothetical protein J645_3982, partial [Acinetobacter baumannii 1287985] EXI51498.1 hypothetical protein J645_3547, partial [Acinetobacter baumannii 1287985] EXI54817.1 hypothetical protein J645_2357, partial [Acinetobacter baumannii 1287985] EXI55511.1 hypothetical protein J645_1637, partial [Acinetobacter baumannii 1287985] EZI72841.1 hypothetical protein J985_3398, partial [Acinetobacter baumannii 44298_9] EZI76344.1 hypothetical protein J985_1118, partial [Acinetobacter baumannii 44298_9] EZI76700.1 hypothetical protein J985_1008, partial [Acinetobacter baumannii 44298_9] Length = 62 Score = 79.3 bits (194), Expect = 3e-18 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPSAVIPSGHSYPAMRLAPQQVHQRYVHPGPLVLGTDPFNIPTPTADRD 1 M SAVIPS HSYPAMRLA Q VHQR+VH GPLVLG DP P PT DRD Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRD 49