BLASTX nr result
ID: Glycyrrhiza30_contig00004433
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00004433 (741 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP49831.1 hypothetical protein KK1_028427 [Cajanus cajan] 72 2e-13 XP_003608044.1 hypothetical protein MTR_4g087080 [Medicago trunc... 68 9e-12 KHN32376.1 hypothetical protein glysoja_032559 [Glycine soja] KR... 68 1e-11 XP_007156526.1 hypothetical protein PHAVU_003G293400g [Phaseolus... 68 1e-11 KRH50229.1 hypothetical protein GLYMA_07G209200 [Glycine max] 65 9e-11 KHN31047.1 hypothetical protein glysoja_020345 [Glycine soja] 65 1e-10 >KYP49831.1 hypothetical protein KK1_028427 [Cajanus cajan] Length = 55 Score = 72.4 bits (176), Expect = 2e-13 Identities = 36/55 (65%), Positives = 38/55 (69%) Frame = +1 Query: 244 MVIHRMELCIAMVRMXXXXXXXXXXXXXXXQERTTEPLAPLNRASTPLPFYGYLR 408 MVIHR+ELCIAMVRM Q+RTTEPL LNRASTPLPFYGYLR Sbjct: 1 MVIHRLELCIAMVRMAIEFVMSVAETVVIVQQRTTEPLGSLNRASTPLPFYGYLR 55 >XP_003608044.1 hypothetical protein MTR_4g087080 [Medicago truncatula] AES90241.1 hypothetical protein MTR_4g087080 [Medicago truncatula] Length = 55 Score = 68.2 bits (165), Expect = 9e-12 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +1 Query: 244 MVIHRMELCIAMVRMXXXXXXXXXXXXXXXQERTTEPLAPLNRASTPLPFYGYLR 408 MV+HR+ELCI+MVRM QER +EP +P+NRA+TPLPFYGYLR Sbjct: 1 MVVHRIELCISMVRMAIEFVMAVAETVVIVQERNSEPFSPINRANTPLPFYGYLR 55 >KHN32376.1 hypothetical protein glysoja_032559 [Glycine soja] KRH71193.1 hypothetical protein GLYMA_02G135800 [Glycine max] Length = 55 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/55 (60%), Positives = 36/55 (65%) Frame = +1 Query: 244 MVIHRMELCIAMVRMXXXXXXXXXXXXXXXQERTTEPLAPLNRASTPLPFYGYLR 408 MVIHR+ELCI MVR+ Q+RT EPL LNRASTPLPFYGYLR Sbjct: 1 MVIHRLELCITMVRLAIEFVVSVAETVVIVQQRTAEPLGTLNRASTPLPFYGYLR 55 >XP_007156526.1 hypothetical protein PHAVU_003G293400g [Phaseolus vulgaris] ESW28520.1 hypothetical protein PHAVU_003G293400g [Phaseolus vulgaris] Length = 55 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/55 (60%), Positives = 36/55 (65%) Frame = +1 Query: 244 MVIHRMELCIAMVRMXXXXXXXXXXXXXXXQERTTEPLAPLNRASTPLPFYGYLR 408 MVIHR+ELCI MVR+ Q+RT EPL LNRASTPLPFYGYLR Sbjct: 1 MVIHRLELCITMVRLAIEFVMSVAETVVVVQQRTAEPLGSLNRASTPLPFYGYLR 55 >KRH50229.1 hypothetical protein GLYMA_07G209200 [Glycine max] Length = 55 Score = 65.5 bits (158), Expect = 9e-11 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = +1 Query: 244 MVIHRMELCIAMVRMXXXXXXXXXXXXXXXQERTTEPLAPLNRASTPLPFYGYLR 408 MVIHR+ELCI MV++ Q+RT EPL LNRASTPLPFYGYLR Sbjct: 1 MVIHRLELCINMVQLAIEFVVSVAETVVIVQQRTVEPLGTLNRASTPLPFYGYLR 55 >KHN31047.1 hypothetical protein glysoja_020345 [Glycine soja] Length = 55 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = +1 Query: 244 MVIHRMELCIAMVRMXXXXXXXXXXXXXXXQERTTEPLAPLNRASTPLPFYGYLR 408 MVIHR+ELCI MV++ Q+RT EPL LNRASTPLPFYGYLR Sbjct: 1 MVIHRLELCINMVQLAIEFVVSVAETVVIVQQRTVEPLGMLNRASTPLPFYGYLR 55