BLASTX nr result
ID: Glycyrrhiza30_contig00004235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00004235 (457 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU46231.1 hypothetical protein TSUD_244490, partial [Trifolium ... 102 1e-22 KOM49035.1 hypothetical protein LR48_Vigan07g273900 [Vigna angul... 102 1e-22 XP_017430550.1 PREDICTED: BTB/POZ domain-containing protein At2g... 102 1e-22 BAT82897.1 hypothetical protein VIGAN_03296900 [Vigna angularis ... 102 1e-22 XP_014504792.1 PREDICTED: BTB/POZ domain-containing protein At2g... 102 1e-22 XP_007160598.1 hypothetical protein PHAVU_001G001100g [Phaseolus... 102 1e-22 OMP09694.1 hypothetical protein COLO4_05222 [Corchorus olitorius] 93 2e-22 XP_003615337.2 BTB/POZ domain plant protein [Medicago truncatula... 102 2e-22 XP_014622682.1 PREDICTED: BTB/POZ domain-containing protein At2g... 99 2e-21 XP_003545003.1 PREDICTED: BTB/POZ domain-containing protein At2g... 99 2e-21 XP_014622681.1 PREDICTED: BTB/POZ domain-containing protein At2g... 99 2e-21 XP_018836408.1 PREDICTED: BTB/POZ domain-containing protein At2g... 97 2e-20 XP_018836406.1 PREDICTED: BTB/POZ domain-containing protein At2g... 97 2e-20 XP_015884136.1 PREDICTED: BTB/POZ domain-containing protein At2g... 96 3e-20 XP_011074097.1 PREDICTED: BTB/POZ domain-containing protein At2g... 94 2e-19 XP_012073656.1 PREDICTED: BTB/POZ domain-containing protein At2g... 94 2e-19 XP_012073654.1 PREDICTED: BTB/POZ domain-containing protein At2g... 94 2e-19 XP_004512608.1 PREDICTED: BTB/POZ domain-containing protein At2g... 93 3e-19 XP_004512607.1 PREDICTED: BTB/POZ domain-containing protein At2g... 93 3e-19 XP_004291228.1 PREDICTED: BTB/POZ domain-containing protein At2g... 92 6e-19 >GAU46231.1 hypothetical protein TSUD_244490, partial [Trifolium subterraneum] Length = 757 Score = 102 bits (255), Expect = 1e-22 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIVGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 713 SWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 757 >KOM49035.1 hypothetical protein LR48_Vigan07g273900 [Vigna angularis] Length = 796 Score = 102 bits (255), Expect = 1e-22 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIVGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 752 SWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 796 >XP_017430550.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vigna angularis] XP_017430551.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vigna angularis] Length = 802 Score = 102 bits (255), Expect = 1e-22 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIVGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 758 SWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 802 >BAT82897.1 hypothetical protein VIGAN_03296900 [Vigna angularis var. angularis] Length = 802 Score = 102 bits (255), Expect = 1e-22 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIVGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 758 SWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 802 >XP_014504792.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vigna radiata var. radiata] Length = 802 Score = 102 bits (255), Expect = 1e-22 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIVGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 758 SWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 802 >XP_007160598.1 hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris] XP_007160599.1 hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris] ESW32592.1 hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris] ESW32593.1 hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris] Length = 802 Score = 102 bits (255), Expect = 1e-22 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIVGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 758 SWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 802 >OMP09694.1 hypothetical protein COLO4_05222 [Corchorus olitorius] Length = 53 Score = 93.2 bits (230), Expect = 2e-22 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWP+ GPNALLPFR+FRV+LTGPTTD +NPWNFCIC+LELYGYF Sbjct: 9 SWPVTGPNALLPFRFFRVLLTGPTTDSSNPWNFCICFLELYGYF 52 >XP_003615337.2 BTB/POZ domain plant protein [Medicago truncatula] AES98295.2 BTB/POZ domain plant protein [Medicago truncatula] Length = 799 Score = 102 bits (254), Expect = 2e-22 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWP+VGPNALLPFRYFRVVLTGPTTD TNPWNFCICYLELYGYFL Sbjct: 755 SWPVVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYFL 799 >XP_014622682.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X3 [Glycine max] Length = 698 Score = 99.4 bits (246), Expect = 2e-21 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPI+GPNALLPFRYFRVVLTG TTD TNPWNFCICYLELYGYFL Sbjct: 654 SWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYFL 698 >XP_003545003.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Glycine max] KHN12601.1 BTB/POZ domain-containing protein [Glycine soja] KRH17515.1 hypothetical protein GLYMA_14G223400 [Glycine max] KRH17516.1 hypothetical protein GLYMA_14G223400 [Glycine max] KRH17517.1 hypothetical protein GLYMA_14G223400 [Glycine max] Length = 802 Score = 99.4 bits (246), Expect = 2e-21 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPI+GPNALLPFRYFRVVLTG TTD TNPWNFCICYLELYGYFL Sbjct: 758 SWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYFL 802 >XP_014622681.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Glycine max] KRH17518.1 hypothetical protein GLYMA_14G223400 [Glycine max] Length = 806 Score = 99.4 bits (246), Expect = 2e-21 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPI+GPNALLPFRYFRVVLTG TTD TNPWNFCICYLELYGYFL Sbjct: 762 SWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYFL 806 >XP_018836408.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Juglans regia] Length = 778 Score = 96.7 bits (239), Expect = 2e-20 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWP+VGPNALLPFR+FRV+LT PTTD+TNPWNFCIC+LELYGYF Sbjct: 734 SWPVVGPNALLPFRFFRVILTSPTTDVTNPWNFCICFLELYGYF 777 >XP_018836406.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Juglans regia] XP_018836407.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Juglans regia] Length = 805 Score = 96.7 bits (239), Expect = 2e-20 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWP+VGPNALLPFR+FRV+LT PTTD+TNPWNFCIC+LELYGYF Sbjct: 761 SWPVVGPNALLPFRFFRVILTSPTTDVTNPWNFCICFLELYGYF 804 >XP_015884136.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Ziziphus jujuba] XP_015884137.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Ziziphus jujuba] Length = 804 Score = 96.3 bits (238), Expect = 3e-20 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWPI+GPNALLPFR+FRVVLTGPTTD++NPWNFCIC LELYGYF Sbjct: 760 SWPIIGPNALLPFRFFRVVLTGPTTDVSNPWNFCICLLELYGYF 803 >XP_011074097.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum indicum] Length = 804 Score = 94.0 bits (232), Expect = 2e-19 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWP+VGPNALLPFR+FR VLT PTTDITNPW+FCIC+LELYGYF Sbjct: 760 SWPVVGPNALLPFRFFRAVLTAPTTDITNPWSFCICFLELYGYF 803 >XP_012073656.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Jatropha curcas] Length = 694 Score = 93.6 bits (231), Expect = 2e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWPI GPN+LLPFRYFRV+LTGPTTD +NPWN CICYLELYGYF Sbjct: 650 SWPITGPNSLLPFRYFRVLLTGPTTDASNPWNLCICYLELYGYF 693 >XP_012073654.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Jatropha curcas] XP_012073655.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Jatropha curcas] Length = 804 Score = 93.6 bits (231), Expect = 2e-19 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWPI GPN+LLPFRYFRV+LTGPTTD +NPWN CICYLELYGYF Sbjct: 760 SWPITGPNSLLPFRYFRVLLTGPTTDASNPWNLCICYLELYGYF 803 >XP_004512608.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Cicer arietinum] XP_004512609.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Cicer arietinum] XP_004512610.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X2 [Cicer arietinum] Length = 795 Score = 93.2 bits (230), Expect = 3e-19 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIV PNALLPFRYFR+ LTGPTTD TNPWNF ICY ELYGYFL Sbjct: 751 SWPIVAPNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYFL 795 >XP_004512607.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform X1 [Cicer arietinum] Length = 815 Score = 93.2 bits (230), Expect = 3e-19 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYFL 321 SWPIV PNALLPFRYFR+ LTGPTTD TNPWNF ICY ELYGYFL Sbjct: 771 SWPIVAPNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYFL 815 >XP_004291228.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria vesca subsp. vesca] XP_011459073.1 PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria vesca subsp. vesca] Length = 803 Score = 92.4 bits (228), Expect = 6e-19 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -3 Query: 455 SWPIVGPNALLPFRYFRVVLTGPTTDITNPWNFCICYLELYGYF 324 SWP+ GPNALLPFR+FRVVLTGPT D +NPWNFCIC+LELYGYF Sbjct: 759 SWPVTGPNALLPFRFFRVVLTGPTMDASNPWNFCICFLELYGYF 802