BLASTX nr result
ID: Glycyrrhiza30_contig00003887
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00003887 (217 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAN69566.1 hypothetical protein Abol_046_003 [Acetobacter orlean... 64 9e-12 >GAN69566.1 hypothetical protein Abol_046_003 [Acetobacter orleanensis JCM 7639] GAN61743.1 hypothetical protein Abin_001_001 [Acetobacter indonesiensis 5H-1] Length = 77 Score = 63.5 bits (153), Expect = 9e-12 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +1 Query: 1 GNSWFSAKAI*VAPRVNTPGGRALDGLGPPTAVPNPTKLRIPES 132 GNSWFSAK+I V + TPGGRALDGLG P A+PN TKLRIP S Sbjct: 11 GNSWFSAKSIEVDRQEFTPGGRALDGLGGPKALPNLTKLRIPGS 54