BLASTX nr result
ID: Glycyrrhiza30_contig00003273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00003273 (201 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SDK62063.1 hypothetical protein SAMN05216468_1228 [Bifidobacteri... 88 4e-21 KFI98678.1 cell wall-associated hydrolase [Bifidobacterium sterc... 87 7e-21 OLO13425.1 hypothetical protein BUV99_11835 [Corynebacterium dip... 77 4e-17 WP_050557007.1 hypothetical protein [Acinetobacter baumannii] OL... 77 4e-17 EGG54221.1 hypothetical protein HMPREF9439_01519 [Parasutterella... 74 4e-16 OKO61031.1 hypothetical protein BSF34_22450 [Escherichia coli] O... 74 5e-16 OKF00517.1 hypothetical protein BL120_27570 [Klebsiella pneumoniae] 74 5e-16 EEB31975.1 hypothetical protein DESPIG_03156 [Desulfovibrio pige... 74 1e-15 EEX74024.1 hypothetical protein GCWU000323_01831 [Leptotrichia h... 72 1e-15 APU76745.1 hypothetical protein BMI84_15395 [Vibrio parahaemolyt... 73 1e-15 ACS96861.1 cell wall-associated hydrolase [Aggregatibacter aphro... 75 2e-15 EFE73543.1 LOW QUALITY PROTEIN: conserved hypothetical protein, ... 72 2e-15 EFD68586.1 conserved hypothetical protein [Streptomyces lividans... 72 2e-15 EFH28519.1 LOW QUALITY PROTEIN: conserved hypothetical protein, ... 72 3e-15 CNT62590.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] 75 3e-15 ANA08046.1 cell wall-associated hydrolase [uncultured bacterium ... 71 4e-15 EXV31665.1 hypothetical protein J843_3846, partial [Acinetobacte... 71 4e-15 EYS19136.1 hypothetical protein J972_4153, partial [Acinetobacte... 71 4e-15 EXI47625.1 hypothetical protein J648_3462, partial [Acinetobacte... 71 4e-15 EXT63604.1 hypothetical protein J771_4023, partial [Acinetobacte... 71 4e-15 >SDK62063.1 hypothetical protein SAMN05216468_1228 [Bifidobacterium breve] Length = 115 Score = 88.2 bits (217), Expect = 4e-21 Identities = 42/62 (67%), Positives = 50/62 (80%) Frame = -2 Query: 188 SHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY*EQASSNLQRPRKIGTK 9 ++L A FPLRCFQRLSLP++A R CHWRDNR+TRG ST VLSY QASS +R ++I TK Sbjct: 43 AYLGAGFPLRCFQRLSLPNVANRPCHWRDNRHTRGSSTQVLSYYGQASSTFRRAQRIETK 102 Query: 8 LS 3 LS Sbjct: 103 LS 104 >KFI98678.1 cell wall-associated hydrolase [Bifidobacterium stercoris JCM 15918] Length = 113 Score = 87.4 bits (215), Expect = 7e-21 Identities = 43/65 (66%), Positives = 49/65 (75%) Frame = -2 Query: 197 PGRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY*EQASSNLQRPRKI 18 P +L A FPLRCFQRLSLP++A R C WRDNR+TRG ST VLSY QASS QR ++I Sbjct: 38 PWNPNLGAGFPLRCFQRLSLPNVANRPCRWRDNRHTRGSSTQVLSYYGQASSGFQRAQRI 97 Query: 17 GTKLS 3 TKLS Sbjct: 98 ETKLS 102 >OLO13425.1 hypothetical protein BUV99_11835 [Corynebacterium diphtheriae] Length = 67 Score = 76.6 bits (187), Expect = 4e-17 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -2 Query: 194 GRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 G+S+LE FPLRCFQRLSLP++ATR+C WR NRYTRG ST VLSY Sbjct: 23 GKSYLEVGFPLRCFQRLSLPNIATRRCDWRHNRYTRGSSTLVLSY 67 >WP_050557007.1 hypothetical protein [Acinetobacter baumannii] OLU92949.1 hypothetical protein AWU46_0217185 [Acinetobacter baumannii] OLV00576.1 hypothetical protein AWU47_0205165 [Acinetobacter baumannii] OLV01391.1 hypothetical protein AWU51_0210980 [Acinetobacter baumannii] OLV05362.1 hypothetical protein AWU50_0214345 [Acinetobacter baumannii] OLV07071.1 hypothetical protein AWU52_0218435 [Acinetobacter baumannii] Length = 67 Score = 76.6 bits (187), Expect = 4e-17 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -2 Query: 194 GRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 G+S+LE FPLRCFQRLSLP++ATR+C WR NRYTRG ST VLSY Sbjct: 23 GKSYLEVGFPLRCFQRLSLPNIATRRCDWRHNRYTRGSSTLVLSY 67 >EGG54221.1 hypothetical protein HMPREF9439_01519 [Parasutterella excrementihominis YIT 11859] Length = 76 Score = 74.3 bits (181), Expect = 4e-16 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 2 ETVWSLSSVGAADLRKPAPSTRGPEWTHLWCIGCHASGIA 121 ETVWSLS+VG L APSTRGPEWTHLWC GCHASGIA Sbjct: 36 ETVWSLSAVGVGRLTGAAPSTRGPEWTHLWCTGCHASGIA 75 >OKO61031.1 hypothetical protein BSF34_22450 [Escherichia coli] ONG34793.1 hypothetical protein BXT93_11560 [Escherichia coli] Length = 69 Score = 73.9 bits (180), Expect = 5e-16 Identities = 34/45 (75%), Positives = 35/45 (77%) Frame = -2 Query: 194 GRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 GR+HL ASF LRCFQ LSLPHLAT QCHW DN T STPVLSY Sbjct: 25 GRTHLGASFVLRCFQHLSLPHLATGQCHWHDNPNTSDASTPVLSY 69 >OKF00517.1 hypothetical protein BL120_27570 [Klebsiella pneumoniae] Length = 69 Score = 73.9 bits (180), Expect = 5e-16 Identities = 34/45 (75%), Positives = 35/45 (77%) Frame = -2 Query: 194 GRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 GR+HL ASF LRCFQ LSLPHLAT QCHW DN T STPVLSY Sbjct: 25 GRTHLGASFVLRCFQHLSLPHLATGQCHWHDNPNTSDASTPVLSY 69 >EEB31975.1 hypothetical protein DESPIG_03156 [Desulfovibrio piger ATCC 29098] Length = 112 Score = 74.3 bits (181), Expect = 1e-15 Identities = 38/53 (71%), Positives = 40/53 (75%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSAVI ST SY A+PLA Q +HQ CVH GPLVLG G S PTEDRDQTVS Sbjct: 1 MLSAVIPSTHSYPAVPLARQQVHQWCVHPGPLVLGTGPFNSPTPTEDRDQTVS 53 >EEX74024.1 hypothetical protein GCWU000323_01831 [Leptotrichia hofstadii F0254] Length = 48 Score = 72.4 bits (176), Expect = 1e-15 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -2 Query: 188 SHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 +HL+A FPLRCFQRLS+P + T+ CHWRDN Y RG+S PVLSY Sbjct: 6 THLKAGFPLRCFQRLSVPDVTTQPCHWRDNWYIRGLSNPVLSY 48 >APU76745.1 hypothetical protein BMI84_15395 [Vibrio parahaemolyticus] Length = 63 Score = 72.8 bits (177), Expect = 1e-15 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -2 Query: 194 GRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 G++HL A FPLRCFQRLS+P+LAT QC WR N TRG STPVLSY Sbjct: 19 GKTHLRARFPLRCFQRLSIPNLATGQCVWRHNPNTRGSSTPVLSY 63 >ACS96861.1 cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] ACS96997.1 cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] ACS97765.1 cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] ACS98076.1 cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] ACS98254.1 cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] ACS98444.1 cell wall-associated hydrolase [Aggregatibacter aphrophilus NJ8700] Length = 144 Score = 74.7 bits (182), Expect = 2e-15 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSA+ISS LSY AM LA QP HQRCVHSGPLVLGA S PT DRD+TVS Sbjct: 1 MLSALISSALSYPAMRLATQPEHQRCVHSGPLVLGAAPTNSPTPTADRDRTVS 53 >EFE73543.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces roseosporus NRRL 15998] EFE75469.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces roseosporus NRRL 15998] EFE75757.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces roseosporus NRRL 15998] Length = 50 Score = 71.6 bits (174), Expect = 2e-15 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 200 GPGRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 G G +HLEA FPLRCFQRLS P++A + C W+DN +TRG S PVLSY Sbjct: 4 GGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLSY 50 >EFD68586.1 conserved hypothetical protein [Streptomyces lividans TK24] EFD68879.1 conserved hypothetical protein [Streptomyces lividans TK24] EFD70119.1 conserved hypothetical protein [Streptomyces lividans TK24] EFD70529.1 conserved hypothetical protein [Streptomyces lividans TK24] Length = 66 Score = 72.0 bits (175), Expect = 2e-15 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 200 GPGRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 G G HLEA FPLRCFQRLSLP++A + C W+DN +TRG S PVLSY Sbjct: 20 GGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 66 >EFH28519.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces sviceus ATCC 29083] EFH28707.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces sviceus ATCC 29083] EFH28779.1 LOW QUALITY PROTEIN: conserved hypothetical protein, partial [Streptomyces sviceus ATCC 29083] Length = 74 Score = 72.0 bits (175), Expect = 3e-15 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 200 GPGRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 G G HLEA FPLRCFQRLSLP++A + C W+DN +TRG S PVLSY Sbjct: 28 GGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLSY 74 >CNT62590.1 Cell wall-associated hydrolase [Neisseria gonorrhoeae] Length = 177 Score = 74.7 bits (182), Expect = 3e-15 Identities = 39/53 (73%), Positives = 42/53 (79%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSA+ISS LSY AM LA QP+HQR VHSGPLVLGA +K PT DRDQTVS Sbjct: 1 MLSALISSELSYPAMQLALQPVHQRFVHSGPLVLGAAPVKLPTPTADRDQTVS 53 >ANA08046.1 cell wall-associated hydrolase [uncultured bacterium 5G4] Length = 52 Score = 71.2 bits (173), Expect = 4e-15 Identities = 33/45 (73%), Positives = 36/45 (80%) Frame = -2 Query: 194 GRSHLEASFPLRCFQRLSLPHLATRQCHWRDNRYTRGVSTPVLSY 60 GRS+LE F LRCFQRLS P LATRQC W++NRYT G S PVLSY Sbjct: 8 GRSNLEMGFALRCFQRLSRPDLATRQCPWQNNRYTSGPSIPVLSY 52 >EXV31665.1 hypothetical protein J843_3846, partial [Acinetobacter baumannii 25935_10] EXV34157.1 hypothetical protein J843_2254, partial [Acinetobacter baumannii 25935_10] EXV34793.1 hypothetical protein J843_1848, partial [Acinetobacter baumannii 25935_10] EXV35167.1 hypothetical protein J843_1621, partial [Acinetobacter baumannii 25935_10] EXW16055.1 hypothetical protein J816_3969, partial [Acinetobacter baumannii 25766_3] EXW23344.1 hypothetical protein J816_1332, partial [Acinetobacter baumannii 25766_3] EYS07183.1 hypothetical protein K012_2053, partial [Acinetobacter baumannii 25569_6] EYS07610.1 hypothetical protein K012_1554, partial [Acinetobacter baumannii 25569_6] KCW23495.1 hypothetical protein J724_3687, partial [Acinetobacter baumannii 1064293_46] Length = 53 Score = 71.2 bits (173), Expect = 4e-15 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSAVI S SY AM LA QP+HQR VHSGPLVLGA LK APT DRD+TVS Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVS 53 >EYS19136.1 hypothetical protein J972_4153, partial [Acinetobacter baumannii 26016_6] EYS20796.1 hypothetical protein J972_3993, partial [Acinetobacter baumannii 26016_6] EYS21492.1 hypothetical protein J972_3541, partial [Acinetobacter baumannii 26016_6] EYS24304.1 hypothetical protein J972_2083, partial [Acinetobacter baumannii 26016_6] EYS24799.1 hypothetical protein J972_1763, partial [Acinetobacter baumannii 26016_6] Length = 55 Score = 71.2 bits (173), Expect = 4e-15 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSAVI S SY AM LA QP+HQR VHSGPLVLGA LK APT DRD+TVS Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVS 53 >EXI47625.1 hypothetical protein J648_3462, partial [Acinetobacter baumannii 10519] EXI49032.1 hypothetical protein J648_3121, partial [Acinetobacter baumannii 10519] Length = 56 Score = 71.2 bits (173), Expect = 4e-15 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSAVI S SY AM LA QP+HQR VHSGPLVLGA LK APT DRD+TVS Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVS 53 >EXT63604.1 hypothetical protein J771_4023, partial [Acinetobacter baumannii 25307_8] EXT64884.1 hypothetical protein J771_3839, partial [Acinetobacter baumannii 25307_8] EXT64935.1 hypothetical protein J771_3820, partial [Acinetobacter baumannii 25307_8] EXT67883.1 hypothetical protein J771_2081, partial [Acinetobacter baumannii 25307_8] EXT68884.1 hypothetical protein J771_1649, partial [Acinetobacter baumannii 25307_8] EXT68987.1 hypothetical protein J771_1422, partial [Acinetobacter baumannii 25307_8] EXW41239.1 hypothetical protein J903_3637, partial [Acinetobacter baumannii 44857_10] EXW42805.1 hypothetical protein J903_3203, partial [Acinetobacter baumannii 44857_10] EXW45415.1 hypothetical protein J903_1558, partial [Acinetobacter baumannii 44857_10] KCX22583.1 hypothetical protein J501_4490, partial [Acinetobacter baumannii 96512] Length = 57 Score = 71.2 bits (173), Expect = 4e-15 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = -1 Query: 159 MLSAVISSTLSYSAMPLA*QPIHQRCVHSGPLVLGAGFLKSAAPTEDRDQTVS 1 MLSAVI S SY AM LA QP+HQR VHSGPLVLGA LK APT DRD+TVS Sbjct: 1 MLSAVIPSEHSYPAMRLASQPVHQRFVHSGPLVLGADPLKFPAPTVDRDRTVS 53