BLASTX nr result
ID: Glycyrrhiza30_contig00003251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00003251 (507 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KQK20681.1 hypothetical protein BRADI_1g63372 [Brachypodium dist... 62 3e-10 KXG18792.1 hypothetical protein SORBI_K033500 [Sorghum bicolor] 61 1e-09 EPS74167.1 hypothetical protein M569_00588, partial [Genlisea au... 61 1e-09 OEL35491.1 hypothetical protein BAE44_0003490 [Dichanthelium oli... 57 3e-08 >KQK20681.1 hypothetical protein BRADI_1g63372 [Brachypodium distachyon] Length = 59 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 47 KRVAGIEPASLAWKARGYSRRSFIILNVSNSKPN 148 +RVAGIEPASLAWKARGYSRR II NVSNSKPN Sbjct: 2 ERVAGIEPASLAWKARGYSRRWLIIYNVSNSKPN 35 >KXG18792.1 hypothetical protein SORBI_K033500 [Sorghum bicolor] Length = 51 Score = 60.8 bits (146), Expect = 1e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 47 KRVAGIEPASLAWKARGYSRRSFIILNVSNSKPN 148 +RVAGIEPASLAWKARGYSRR II +VSNSKPN Sbjct: 15 ERVAGIEPASLAWKARGYSRRWLIIFDVSNSKPN 48 >EPS74167.1 hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +2 Query: 47 KRVAGIEPASLAWKARGYSRRSFIILNVSNSKPN 148 KRVAGIEPASLAWKA+GYSRR F L+VSNSKPN Sbjct: 12 KRVAGIEPASLAWKAKGYSRRRFSSLSVSNSKPN 45 >OEL35491.1 hypothetical protein BAE44_0003490 [Dichanthelium oligosanthes] Length = 51 Score = 57.0 bits (136), Expect = 3e-08 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = +2 Query: 17 SNRINIEIGYKRVAGIEPASLAWKARGYSRRSFIILNVSNSKPN 148 +NRI +RV GIEP LAWKARGYS R II NVSNSKPN Sbjct: 5 TNRIVFLYKMERVVGIEPTLLAWKARGYSGRWLIIFNVSNSKPN 48