BLASTX nr result
ID: Glycyrrhiza30_contig00002991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00002991 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019413059.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 9e-23 XP_019413049.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 9e-23 XP_014502580.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-22 XP_004502080.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-22 XP_013461142.1 PPR containing plant protein [Medicago truncatula... 99 2e-22 ACU23208.1 unknown [Glycine max] 94 2e-22 XP_007141631.1 hypothetical protein PHAVU_008G212400g [Phaseolus... 99 2e-22 KRH23427.1 hypothetical protein GLYMA_13G356700 [Glycine max] 99 3e-22 XP_003542095.2 PREDICTED: pentatricopeptide repeat-containing pr... 99 3e-22 KHN32628.1 Pentatricopeptide repeat-containing protein, mitochon... 98 4e-22 XP_017430371.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 8e-22 GAU35646.1 hypothetical protein TSUD_394860 [Trifolium subterran... 97 8e-22 XP_003546486.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 4e-21 XP_015967681.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 8e-21 KYP44785.1 hypothetical protein KK1_033704 [Cajanus cajan] 91 9e-20 ONI05277.1 hypothetical protein PRUPE_6G365500 [Prunus persica] 91 1e-19 XP_007205009.1 hypothetical protein PRUPE_ppa003637mg [Prunus pe... 91 1e-19 ONI05276.1 hypothetical protein PRUPE_6G365500 [Prunus persica] 91 1e-19 XP_008218493.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 1e-19 CDH30703.1 putative pentatricopeptide repeat-containing protein ... 91 2e-19 >XP_019413059.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial isoform X2 [Lupinus angustifolius] Length = 540 Score = 100 bits (248), Expect = 9e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKE 107 DEYEKLIQSLCLK+LDWETAEKLQEEMKENGLHLKGI+RALIRAVKEM+KE Sbjct: 479 DEYEKLIQSLCLKALDWETAEKLQEEMKENGLHLKGISRALIRAVKEMEKE 529 >XP_019413049.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial isoform X1 [Lupinus angustifolius] OIW17593.1 hypothetical protein TanjilG_11157 [Lupinus angustifolius] Length = 561 Score = 100 bits (248), Expect = 9e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKE 107 DEYEKLIQSLCLK+LDWETAEKLQEEMKENGLHLKGI+RALIRAVKEM+KE Sbjct: 500 DEYEKLIQSLCLKALDWETAEKLQEEMKENGLHLKGISRALIRAVKEMEKE 550 >XP_014502580.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Vigna radiata var. radiata] Length = 542 Score = 99.8 bits (247), Expect = 1e-22 Identities = 50/58 (86%), Positives = 54/58 (93%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEYEKLIQSLCLK+LDWETAEKL EEMKENGLHLKGITR LIR+VKE++K EVVE ES Sbjct: 481 DEYEKLIQSLCLKALDWETAEKLHEEMKENGLHLKGITRGLIRSVKELEK-EVVEGES 537 >XP_004502080.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Cicer arietinum] Length = 581 Score = 99.8 bits (247), Expect = 1e-22 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAESDS 80 DEYEKLIQSLCLK+LDWE AEKLQ+EMKENGLHLKGITRAL+RAVKE + E VEA+SDS Sbjct: 520 DEYEKLIQSLCLKALDWERAEKLQQEMKENGLHLKGITRALVRAVKETEM-EAVEAQSDS 578 >XP_013461142.1 PPR containing plant protein [Medicago truncatula] KEH35176.1 PPR containing plant protein [Medicago truncatula] Length = 562 Score = 99.4 bits (246), Expect = 2e-22 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAESDS 80 DEYEKLIQSLCLK+LDWE AEKLQEEMKE GLHLKGITRAL+RAVKE +K E VEA+S+S Sbjct: 501 DEYEKLIQSLCLKALDWEKAEKLQEEMKEKGLHLKGITRALVRAVKEAEK-EAVEAQSES 559 >ACU23208.1 unknown [Glycine max] Length = 177 Score = 94.0 bits (232), Expect = 2e-22 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY+KLIQSLCLK+LDWE AEKL EEMKE+GLH KGITR LIRAVKEM+K EVVEA S Sbjct: 116 DEYDKLIQSLCLKALDWEMAEKLHEEMKESGLHFKGITRGLIRAVKEMEK-EVVEAGS 172 >XP_007141631.1 hypothetical protein PHAVU_008G212400g [Phaseolus vulgaris] ESW13625.1 hypothetical protein PHAVU_008G212400g [Phaseolus vulgaris] Length = 535 Score = 99.0 bits (245), Expect = 2e-22 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEYEKLIQSLCLK+LDWE AEKL EEMKENGLHLKGITR LIRAVKEM+K EVVE ES Sbjct: 472 DEYEKLIQSLCLKALDWEMAEKLLEEMKENGLHLKGITRGLIRAVKEMEK-EVVEVES 528 >KRH23427.1 hypothetical protein GLYMA_13G356700 [Glycine max] Length = 539 Score = 98.6 bits (244), Expect = 3e-22 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY+KLIQSLCLK+LDW+ AEKLQEEMKE+GLHLKGITR LIRAVKEM+K EVVEAES Sbjct: 478 DEYDKLIQSLCLKALDWKMAEKLQEEMKESGLHLKGITRGLIRAVKEMEK-EVVEAES 534 >XP_003542095.2 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Glycine max] Length = 562 Score = 98.6 bits (244), Expect = 3e-22 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY+KLIQSLCLK+LDW+ AEKLQEEMKE+GLHLKGITR LIRAVKEM+K EVVEAES Sbjct: 501 DEYDKLIQSLCLKALDWKMAEKLQEEMKESGLHLKGITRGLIRAVKEMEK-EVVEAES 557 >KHN32628.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 539 Score = 98.2 bits (243), Expect = 4e-22 Identities = 50/58 (86%), Positives = 55/58 (94%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 +EY+KLIQSLCLK+LDWE AEKLQEEMKE+GLHLKGITR LIRAVKEM+K EVVEAES Sbjct: 478 NEYDKLIQSLCLKALDWEMAEKLQEEMKESGLHLKGITRGLIRAVKEMEK-EVVEAES 534 >XP_017430371.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Vigna angularis] KOM46765.1 hypothetical protein LR48_Vigan07g046900 [Vigna angularis] BAT80985.1 hypothetical protein VIGAN_03061800 [Vigna angularis var. angularis] Length = 548 Score = 97.4 bits (241), Expect = 8e-22 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEYEKLIQSLCLK+LDWETAEKL EEMK+NGLHLKGITR LIR+VKE++K E+VE ES Sbjct: 487 DEYEKLIQSLCLKALDWETAEKLLEEMKDNGLHLKGITRGLIRSVKELEK-EIVEGES 543 >GAU35646.1 hypothetical protein TSUD_394860 [Trifolium subterraneum] Length = 571 Score = 97.4 bits (241), Expect = 8e-22 Identities = 48/60 (80%), Positives = 54/60 (90%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAESDS 80 DEYEKLIQSLCLK+LDWE AEKLQEEMKE G+HLKGITRAL+RAVKE +K E VEA+ D+ Sbjct: 510 DEYEKLIQSLCLKALDWERAEKLQEEMKEKGIHLKGITRALVRAVKEAEK-EAVEAQGDT 568 >XP_003546486.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Glycine max] KHM98739.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] KRH09898.1 hypothetical protein GLYMA_15G017400 [Glycine max] KRH09899.1 hypothetical protein GLYMA_15G017400 [Glycine max] KRH09900.1 hypothetical protein GLYMA_15G017400 [Glycine max] KRH09901.1 hypothetical protein GLYMA_15G017400 [Glycine max] Length = 538 Score = 95.5 bits (236), Expect = 4e-21 Identities = 49/58 (84%), Positives = 53/58 (91%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY+KLIQSLCLK+LDWE AEKL EEMKE+GLHLKGITR LIRAVKEM+K EVVEA S Sbjct: 477 DEYDKLIQSLCLKALDWEMAEKLHEEMKESGLHLKGITRGLIRAVKEMEK-EVVEAGS 533 >XP_015967681.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Arachis duranensis] Length = 600 Score = 94.7 bits (234), Expect = 8e-21 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEM 116 DEYEKLIQSLCLK+LDWE AEKLQEEMKENGLHLKGITRALIRAVKEM Sbjct: 503 DEYEKLIQSLCLKALDWEMAEKLQEEMKENGLHLKGITRALIRAVKEM 550 >KYP44785.1 hypothetical protein KK1_033704 [Cajanus cajan] Length = 382 Score = 90.9 bits (224), Expect = 9e-20 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY+KLIQSLCLK LDWE AEKL EEMKENGL LKGITR LIRAVKE++ E VEAES Sbjct: 321 DEYDKLIQSLCLKGLDWERAEKLHEEMKENGLLLKGITRGLIRAVKELE-NEAVEAES 377 >ONI05277.1 hypothetical protein PRUPE_6G365500 [Prunus persica] Length = 472 Score = 91.3 bits (225), Expect = 1e-19 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY KLIQSLCLK+LDWETAEKL EEMK+NGLHL GITR LI+AVKE+ KEE +E E+ Sbjct: 411 DEYNKLIQSLCLKALDWETAEKLLEEMKDNGLHLNGITRGLIKAVKEL-KEEKIETEN 467 >XP_007205009.1 hypothetical protein PRUPE_ppa003637mg [Prunus persica] Length = 560 Score = 91.3 bits (225), Expect = 1e-19 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY KLIQSLCLK+LDWETAEKL EEMK+NGLHL GITR LI+AVKE+ KEE +E E+ Sbjct: 499 DEYNKLIQSLCLKALDWETAEKLLEEMKDNGLHLNGITRGLIKAVKEL-KEEKIETEN 555 >ONI05276.1 hypothetical protein PRUPE_6G365500 [Prunus persica] Length = 576 Score = 91.3 bits (225), Expect = 1e-19 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY KLIQSLCLK+LDWETAEKL EEMK+NGLHL GITR LI+AVKE+ KEE +E E+ Sbjct: 515 DEYNKLIQSLCLKALDWETAEKLLEEMKDNGLHLNGITRGLIKAVKEL-KEEKIETEN 571 >XP_008218493.1 PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Prunus mume] Length = 576 Score = 91.3 bits (225), Expect = 1e-19 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY KLIQSLCLK+LDWETAEKL EEMK+NGLHL GITR LI+AVKE+ KEE +E E+ Sbjct: 515 DEYNKLIQSLCLKALDWETAEKLLEEMKDNGLHLNGITRGLIKAVKEL-KEEKIETEN 571 >CDH30703.1 putative pentatricopeptide repeat-containing protein [Cajanus cajan] Length = 534 Score = 90.9 bits (224), Expect = 2e-19 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = -2 Query: 259 DEYEKLIQSLCLKSLDWETAEKLQEEMKENGLHLKGITRALIRAVKEMDKEEVVEAES 86 DEY+KLIQSLCLK LDWE AEKL EEMKENGL LKGITR LIRAVKE++ E VEAES Sbjct: 473 DEYDKLIQSLCLKGLDWERAEKLHEEMKENGLLLKGITRGLIRAVKELE-NEAVEAES 529