BLASTX nr result
ID: Glycyrrhiza30_contig00002846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00002846 (514 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP73575.1 hypothetical protein KK1_006218 [Cajanus cajan] 78 3e-16 XP_003555729.1 PREDICTED: small acidic protein 1 [Glycine max] K... 77 6e-16 XP_016177303.1 PREDICTED: small acidic protein 1 [Arachis ipaensis] 73 4e-14 XP_015941117.1 PREDICTED: small acidic protein 1 [Arachis durane... 73 4e-14 XP_017412770.1 PREDICTED: small acidic protein 1 [Vigna angulari... 71 2e-13 OIW07672.1 hypothetical protein TanjilG_07714 [Lupinus angustifo... 69 9e-13 XP_014512611.1 PREDICTED: small acidic protein 1 [Vigna radiata ... 68 3e-12 OAY55464.1 hypothetical protein MANES_03G156300 [Manihot esculenta] 63 2e-10 XP_012077649.1 PREDICTED: small acidic protein 1 [Jatropha curcas] 63 3e-10 XP_006493997.1 PREDICTED: small acidic protein 1 [Citrus sinensis] 62 5e-10 XP_008460713.1 PREDICTED: small acidic protein 1 [Cucumis melo] 62 7e-10 XP_004147176.1 PREDICTED: small acidic protein 1 [Cucumis sativu... 62 7e-10 XP_018838069.1 PREDICTED: small acidic protein 1 [Juglans regia] 62 1e-09 XP_004497783.1 PREDICTED: small acidic protein 1 [Cicer arietinum] 60 3e-09 XP_015574032.1 PREDICTED: small acidic protein 1 [Ricinus commun... 60 3e-09 XP_004496569.1 PREDICTED: small acidic protein 1-like [Cicer ari... 60 4e-09 XP_002314520.1 hypothetical protein POPTR_0010s07360g [Populus t... 59 1e-08 XP_002285566.1 PREDICTED: small acidic protein 1 [Vitis vinifera] 59 1e-08 XP_015887720.1 PREDICTED: small acidic protein 1 [Ziziphus jujuba] 58 2e-08 XP_010023791.1 PREDICTED: small acidic protein 1 [Eucalyptus gra... 59 2e-08 >KYP73575.1 hypothetical protein KK1_006218 [Cajanus cajan] Length = 61 Score = 78.2 bits (191), Expect = 3e-16 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = -3 Query: 383 IMRPMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 +MR M+LFGEMEEQVS MAMDVDDVDPLEIFAEGVMAADNKL Sbjct: 1 MMRAMELFGEMEEQVSAMAMDVDDVDPLEIFAEGVMAADNKL 42 >XP_003555729.1 PREDICTED: small acidic protein 1 [Glycine max] KRG90303.1 hypothetical protein GLYMA_20G081600 [Glycine max] Length = 61 Score = 77.4 bits (189), Expect = 6e-16 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 383 IMRPMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 +MR MDLFGEM+EQVS+MAMDVDDVDPLEIFAEGV+AADNKL Sbjct: 1 MMRSMDLFGEMDEQVSSMAMDVDDVDPLEIFAEGVIAADNKL 42 >XP_016177303.1 PREDICTED: small acidic protein 1 [Arachis ipaensis] Length = 62 Score = 72.8 bits (177), Expect = 4e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PMDLFGEM+EQVS MAMDVDDVDPLEIF EGV++ADNKL Sbjct: 5 PMDLFGEMDEQVSAMAMDVDDVDPLEIFPEGVISADNKL 43 >XP_015941117.1 PREDICTED: small acidic protein 1 [Arachis duranensis] Length = 62 Score = 72.8 bits (177), Expect = 4e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PMDLFGEM+EQVS MAMDVDDVDPLEIF EGV++ADNKL Sbjct: 5 PMDLFGEMDEQVSAMAMDVDDVDPLEIFPEGVISADNKL 43 >XP_017412770.1 PREDICTED: small acidic protein 1 [Vigna angularis] KOM34490.1 hypothetical protein LR48_Vigan02g064000 [Vigna angularis] Length = 65 Score = 70.9 bits (172), Expect = 2e-13 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 386 KIMRPMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 K+MR M+LFGEM+EQVS+MAMDVDDVDPLE FAEGV+ AD KL Sbjct: 4 KMMRAMELFGEMDEQVSSMAMDVDDVDPLETFAEGVITADLKL 46 >OIW07672.1 hypothetical protein TanjilG_07714 [Lupinus angustifolius] Length = 68 Score = 69.3 bits (168), Expect = 9e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PMDLFGEME+QVSTMAMDVDDVDPLEIFA+GV+ +DNKL Sbjct: 12 PMDLFGEMEDQVSTMAMDVDDVDPLEIFADGVI-SDNKL 49 >XP_014512611.1 PREDICTED: small acidic protein 1 [Vigna radiata var. radiata] Length = 61 Score = 67.8 bits (164), Expect = 3e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -3 Query: 383 IMRPMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 ++R M+LFGEM+EQVS+MAMDVDDVDPLE FAEGV+ AD KL Sbjct: 1 MLRAMELFGEMDEQVSSMAMDVDDVDPLETFAEGVITADLKL 42 >OAY55464.1 hypothetical protein MANES_03G156300 [Manihot esculenta] Length = 62 Score = 63.2 bits (152), Expect = 2e-10 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -3 Query: 380 MRPM--DLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MRPM D F +MEEQ ST+AMDVDDVDPLEIF EGV+ DNKL Sbjct: 1 MRPMQMDFFADMEEQGSTVAMDVDDVDPLEIFGEGVINVDNKL 43 >XP_012077649.1 PREDICTED: small acidic protein 1 [Jatropha curcas] Length = 62 Score = 62.8 bits (151), Expect = 3e-10 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -3 Query: 380 MRPM--DLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MRPM D F +MEEQ STMAM+VDDVDPLEIF EGV+ DNKL Sbjct: 1 MRPMQMDFFADMEEQGSTMAMEVDDVDPLEIFGEGVINIDNKL 43 >XP_006493997.1 PREDICTED: small acidic protein 1 [Citrus sinensis] Length = 62 Score = 62.0 bits (149), Expect = 5e-10 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -3 Query: 380 MRPMDL--FGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MRPM + FG+ME+Q +T+AMDVDDVDPLEIF EG+++ DNKL Sbjct: 1 MRPMQMEFFGDMEDQGATVAMDVDDVDPLEIFGEGIISIDNKL 43 >XP_008460713.1 PREDICTED: small acidic protein 1 [Cucumis melo] Length = 62 Score = 61.6 bits (148), Expect = 7e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PM+ F E+EEQ ST+AMDVDDVDPLEI EGV++A+NKL Sbjct: 5 PMEFFAELEEQGSTVAMDVDDVDPLEILGEGVISAENKL 43 >XP_004147176.1 PREDICTED: small acidic protein 1 [Cucumis sativus] KGN61541.1 hypothetical protein Csa_2G166190 [Cucumis sativus] Length = 62 Score = 61.6 bits (148), Expect = 7e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PM+ F E+EEQ ST+AMDVDDVDPLEI EGV++A+NKL Sbjct: 5 PMEFFAELEEQGSTVAMDVDDVDPLEILGEGVISAENKL 43 >XP_018838069.1 PREDICTED: small acidic protein 1 [Juglans regia] Length = 90 Score = 61.6 bits (148), Expect = 1e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PMD F EM++Q ST+AMDVDD DPLEIF EGV++ DNKL Sbjct: 33 PMDFFAEMDDQPSTVAMDVDDGDPLEIFGEGVISIDNKL 71 >XP_004497783.1 PREDICTED: small acidic protein 1 [Cicer arietinum] Length = 60 Score = 60.1 bits (144), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = -3 Query: 380 MRPMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MR MDLFGEME+Q+++MAMDVDDV+ E+ A+GV+ +D+KL Sbjct: 1 MRAMDLFGEMEDQITSMAMDVDDVEQFEMLADGVIVSDHKL 41 >XP_015574032.1 PREDICTED: small acidic protein 1 [Ricinus communis] XP_015574033.1 PREDICTED: small acidic protein 1 [Ricinus communis] Length = 62 Score = 60.1 bits (144), Expect = 3e-09 Identities = 29/43 (67%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -3 Query: 380 MRPMDL--FGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MRPM + F +M+EQ S++AMDVDDVDPLEIF EGV++ DNKL Sbjct: 1 MRPMQMEFFADMDEQGSSVAMDVDDVDPLEIFGEGVISVDNKL 43 >XP_004496569.1 PREDICTED: small acidic protein 1-like [Cicer arietinum] Length = 60 Score = 59.7 bits (143), Expect = 4e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 380 MRPMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MR MDLFGEME+Q+++MAMDVDDV+ E+ A+GV+ D+KL Sbjct: 1 MRAMDLFGEMEDQITSMAMDVDDVEQFEMLADGVIVTDHKL 41 >XP_002314520.1 hypothetical protein POPTR_0010s07360g [Populus trichocarpa] EEF00691.1 hypothetical protein POPTR_0010s07360g [Populus trichocarpa] Length = 62 Score = 58.5 bits (140), Expect = 1e-08 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -3 Query: 380 MRPM--DLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 MRPM DLF +MEEQ ST+AMDVDDVD LE+F EGV+ +NKL Sbjct: 1 MRPMQVDLFADMEEQGSTVAMDVDDVDTLEMFGEGVINMENKL 43 >XP_002285566.1 PREDICTED: small acidic protein 1 [Vitis vinifera] Length = 83 Score = 58.9 bits (141), Expect = 1e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 PM+ + E+++Q +T+AMDVDDVDPLEIF EGV++ DNKL Sbjct: 26 PMEYYAELDDQGATVAMDVDDVDPLEIFGEGVISVDNKL 64 >XP_015887720.1 PREDICTED: small acidic protein 1 [Ziziphus jujuba] Length = 61 Score = 57.8 bits (138), Expect = 2e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 371 MDLFGEMEEQVSTMAMDVDDVDPLEIFAEGVMAADNKL 258 M+ FG+MEEQ STMAMDVDDVDPLE+ EGV+ +DNKL Sbjct: 6 MEFFGDMEEQGSTMAMDVDDVDPLEVLGEGVV-SDNKL 42 >XP_010023791.1 PREDICTED: small acidic protein 1 [Eucalyptus grandis] KCW60158.1 hypothetical protein EUGRSUZ_H02882 [Eucalyptus grandis] Length = 92 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 374 PMDLFGEMEEQVSTMAMDVDDVDPLEIF-AEGVMAADNKL 258 PMD F E+E+Q +T+AMDVDDVDPLEIF EGV++ DNKL Sbjct: 34 PMDYFAELEDQGTTVAMDVDDVDPLEIFGGEGVLSVDNKL 73