BLASTX nr result
ID: Glycyrrhiza30_contig00002007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00002007 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU39429.1 hypothetical protein TSUD_289940 [Trifolium subterran... 51 1e-06 >GAU39429.1 hypothetical protein TSUD_289940 [Trifolium subterraneum] Length = 101 Score = 50.8 bits (120), Expect = 1e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 112 SIIALLLFSSNTWRAFQRRVSYEMITVLNEF 204 S+I LLL SSNTWRAFQ+ VSYE ITV+NEF Sbjct: 51 SVICLLLVSSNTWRAFQQVVSYETITVVNEF 81