BLASTX nr result
ID: Glycyrrhiza30_contig00000783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00000783 (860 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22588.1 hypothetical protein TSUD_93560 [Trifolium subterraneum] 65 1e-09 GAU43987.1 hypothetical protein TSUD_135460 [Trifolium subterran... 67 4e-09 XP_013456599.1 cinnamoyl-CoA reductase-like protein [Medicago tr... 67 4e-09 AFK38743.1 unknown [Medicago truncatula] 67 5e-09 XP_003628601.1 cinnamyl alcohol dehydrogenase [Medicago truncatu... 67 5e-09 XP_013445900.1 cinnamyl alcohol dehydrogenase [Medicago truncatu... 67 6e-09 XP_013445901.1 cinnamyl alcohol dehydrogenase [Medicago truncatu... 67 6e-09 XP_003607372.1 cinnamoyl-CoA reductase-like protein [Medicago tr... 67 6e-09 XP_006302493.1 hypothetical protein CARUB_v10020587mg [Capsella ... 67 6e-09 XP_006438962.1 hypothetical protein CICLE_v10031994mg [Citrus cl... 66 8e-09 KMT14525.1 hypothetical protein BVRB_4g072960 [Beta vulgaris sub... 62 1e-08 XP_004505624.1 PREDICTED: cinnamoyl-CoA reductase 1 [Cicer ariet... 65 1e-08 XP_006482920.1 PREDICTED: uncharacterized protein LOC102629110 i... 66 2e-08 KDO37247.1 hypothetical protein CISIN_1g036468mg, partial [Citru... 60 2e-08 XP_013445892.1 cinnamyl alcohol dehydrogenase [Medicago truncatu... 64 2e-08 XP_002513513.1 PREDICTED: cinnamoyl-CoA reductase 1 [Ricinus com... 65 2e-08 KDP22108.1 hypothetical protein JCGZ_25939 [Jatropha curcas] 65 3e-08 XP_013445896.1 cinnamyl alcohol dehydrogenase [Medicago truncatu... 64 3e-08 XP_013445894.1 cinnamyl alcohol dehydrogenase [Medicago truncatu... 64 3e-08 XP_004509912.1 PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer ... 64 3e-08 >GAU22588.1 hypothetical protein TSUD_93560 [Trifolium subterraneum] Length = 126 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M SGEGKVVCVTGASG+IASW+VKFLLQRGYTV Sbjct: 1 MNSGEGKVVCVTGASGYIASWLVKFLLQRGYTV 33 >GAU43987.1 hypothetical protein TSUD_135460 [Trifolium subterraneum] Length = 276 Score = 66.6 bits (161), Expect = 4e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 764 ISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 +SGEGKVVCVTGASGFIASWIVKFLLQRGYTV Sbjct: 1 MSGEGKVVCVTGASGFIASWIVKFLLQRGYTV 32 >XP_013456599.1 cinnamoyl-CoA reductase-like protein [Medicago truncatula] KEH30630.1 cinnamoyl-CoA reductase-like protein [Medicago truncatula] Length = 280 Score = 66.6 bits (161), Expect = 4e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M SGEGKVVCVTGASGFIASW+VKFLLQRGYTV Sbjct: 3 MKSGEGKVVCVTGASGFIASWVVKFLLQRGYTV 35 >AFK38743.1 unknown [Medicago truncatula] Length = 323 Score = 66.6 bits (161), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 764 ISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 +SGEGKVVCVTGASGFIASWIVKFLLQRGYTV Sbjct: 1 MSGEGKVVCVTGASGFIASWIVKFLLQRGYTV 32 >XP_003628601.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] AET03077.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] Length = 323 Score = 66.6 bits (161), Expect = 5e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 764 ISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 +SGEGKVVCVTGASGFIASWIVKFLLQRGYTV Sbjct: 1 MSGEGKVVCVTGASGFIASWIVKFLLQRGYTV 32 >XP_013445900.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] KEH19926.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] Length = 324 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 764 ISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 +SGEGKVVCVTGASGFIASWIVKFLLQRGYTV Sbjct: 1 MSGEGKVVCVTGASGFIASWIVKFLLQRGYTV 32 >XP_013445901.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] KEH19927.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] Length = 326 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 764 ISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 +SGEGKVVCVTGASGFIASWIVKFLLQRGYTV Sbjct: 1 MSGEGKVVCVTGASGFIASWIVKFLLQRGYTV 32 >XP_003607372.1 cinnamoyl-CoA reductase-like protein [Medicago truncatula] AES89569.1 cinnamoyl-CoA reductase-like protein [Medicago truncatula] Length = 327 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M SGEGKVVCVTGASGFIASW+VKFLLQRGYTV Sbjct: 3 MKSGEGKVVCVTGASGFIASWVVKFLLQRGYTV 35 >XP_006302493.1 hypothetical protein CARUB_v10020587mg [Capsella rubella] EOA35391.1 hypothetical protein CARUB_v10020587mg [Capsella rubella] Length = 344 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +2 Query: 722 SQGKSKTCEERKRMISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 SQ +++K+M++GEGKVVCVTGASG+IASWIVK LL RGYTV Sbjct: 12 SQPPPHIIQKKKKMMTGEGKVVCVTGASGYIASWIVKLLLLRGYTV 57 >XP_006438962.1 hypothetical protein CICLE_v10031994mg [Citrus clementina] ESR52202.1 hypothetical protein CICLE_v10031994mg [Citrus clementina] Length = 344 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +2 Query: 734 SKTCEERKRMISGEG--KVVCVTGASGFIASWIVKFLLQRGYTV 859 S T ER+ M+SGEG KVVCVTGASGFIASW+VK LLQRGYTV Sbjct: 13 SFTLREREMMMSGEGEGKVVCVTGASGFIASWLVKLLLQRGYTV 56 >KMT14525.1 hypothetical protein BVRB_4g072960 [Beta vulgaris subsp. vulgaris] Length = 113 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 755 KRMISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 ++++SGEGK VCVTGASG+IASWIVKFLLQRGY V Sbjct: 2 EQVMSGEGKRVCVTGASGYIASWIVKFLLQRGYVV 36 >XP_004505624.1 PREDICTED: cinnamoyl-CoA reductase 1 [Cicer arietinum] Length = 325 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M SGEGKVVCVTGASG+IASW+VKFLLQRGYTV Sbjct: 1 MKSGEGKVVCVTGASGYIASWVVKFLLQRGYTV 33 >XP_006482920.1 PREDICTED: uncharacterized protein LOC102629110 isoform X2 [Citrus sinensis] Length = 650 Score = 65.9 bits (159), Expect = 2e-08 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +2 Query: 734 SKTCEERKRMISGEG--KVVCVTGASGFIASWIVKFLLQRGYTV 859 S T ER+ M+SGEG KVVCVTGASGFIASW+VK LLQRGYTV Sbjct: 13 SFTFREREMMMSGEGEGKVVCVTGASGFIASWLVKLLLQRGYTV 56 Score = 60.1 bits (144), Expect = 1e-06 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 2/35 (5%) Frame = +2 Query: 761 MISGEG--KVVCVTGASGFIASWIVKFLLQRGYTV 859 M+SGEG KVVCVTGASGF+ASW+VK LLQRGYTV Sbjct: 329 MMSGEGEEKVVCVTGASGFVASWLVKLLLQRGYTV 363 >KDO37247.1 hypothetical protein CISIN_1g036468mg, partial [Citrus sinensis] Length = 64 Score = 59.7 bits (143), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 764 ISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 +SG+GKVVCVTGASGFIASW+VK LLQR YTV Sbjct: 1 MSGKGKVVCVTGASGFIASWLVKLLLQRSYTV 32 >XP_013445892.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] KEH19918.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] Length = 277 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M+SGEGKVVCVTGA+GFIASWIVKFLLQ GYTV Sbjct: 1 MMSGEGKVVCVTGANGFIASWIVKFLLQCGYTV 33 >XP_002513513.1 PREDICTED: cinnamoyl-CoA reductase 1 [Ricinus communis] EEF48916.1 cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 402 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +2 Query: 746 EERKRMISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 EE SGEGK VCVTGASG+IASWIVKFLLQRGYTV Sbjct: 74 EEEMSSDSGEGKTVCVTGASGYIASWIVKFLLQRGYTV 111 >KDP22108.1 hypothetical protein JCGZ_25939 [Jatropha curcas] Length = 409 Score = 65.1 bits (157), Expect = 3e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 746 EERKRMISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 EE+ +M SG GK+VCVTGASG+IASW+VKFLL RGYTV Sbjct: 80 EEKTKMSSGAGKIVCVTGASGYIASWLVKFLLLRGYTV 117 >XP_013445896.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] KEH19922.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] Length = 288 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M+SGEGKVVCVTGA+GFIASWIVKFLLQ GYTV Sbjct: 1 MMSGEGKVVCVTGANGFIASWIVKFLLQCGYTV 33 >XP_013445894.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] KEH19920.1 cinnamyl alcohol dehydrogenase [Medicago truncatula] Length = 324 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M+SGEGKVVCVTGA+GFIASWIVKFLLQ GYTV Sbjct: 1 MMSGEGKVVCVTGANGFIASWIVKFLLQCGYTV 33 >XP_004509912.1 PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer arietinum] XP_004509913.1 PREDICTED: cinnamoyl-CoA reductase 1-like [Cicer arietinum] Length = 324 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = +2 Query: 761 MISGEGKVVCVTGASGFIASWIVKFLLQRGYTV 859 M S EGKVVCVTGASGFIASWIVKFLLQRGYTV Sbjct: 1 MSSEEGKVVCVTGASGFIASWIVKFLLQRGYTV 33