BLASTX nr result
ID: Glycyrrhiza30_contig00000446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00000446 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAX66568.1 ORF16-lacZ fusion protein [Salmonella enterica subsp.... 115 9e-32 CSI43085.1 Uncharacterised protein [Shigella sonnei] GAS29422.1 ... 102 6e-27 EWS90747.1 hypothetical protein SSIG_01113 [Streptomyces roseosp... 102 7e-27 EFF91834.1 conserved hypothetical protein [Streptomyces sp. e14] 102 7e-27 EDX22403.1 conserved hypothetical protein [Streptomyces sp. Mg1]... 102 7e-27 AOE11689.1 hypothetical protein [uncultured bacterium] 103 7e-27 AAX67927.1 ORF16-lacZ fusion protein [Salmonella enterica subsp.... 102 1e-26 ABE05727.1 hypothetical protein UTI89_C0218 [Escherichia coli UT... 102 1e-26 ABE08379.1 hypothetical protein UTI89_C2923 [Escherichia coli UT... 102 1e-26 EFJ63628.1 hypothetical protein HMPREF9553_00243, partial [Esche... 102 2e-26 CIC34492.1 Uncharacterised protein [Salmonella enterica subsp. e... 101 3e-26 EDY45007.2 conserved hypothetical protein [Streptomyces sp. SPB074] 100 6e-26 AAX64154.1 ORF16-lacZ fusion protein [Salmonella enterica subsp.... 100 8e-26 JAN31957.1 hypothetical protein [Daphnia magna] 100 8e-26 CCI74526.1 unnamed protein product [Klebsiella pneumoniae subsp.... 100 1e-25 CDO12945.1 unnamed protein product [Klebsiella pneumoniae] 100 1e-25 ABE09160.1 conserved hypothetical protein [Escherichia coli UTI8... 100 2e-25 EDY62143.2 conserved hypothetical protein [Streptomyces pristina... 97 9e-25 EDY48148.1 conserved hypothetical protein [Streptomyces clavulig... 97 2e-24 OCG19290.1 hypothetical protein A9G23_09380 [Gilliamella apicola] 96 4e-24 >AAX66568.1 ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 106 Score = 115 bits (288), Expect = 9e-32 Identities = 59/79 (74%), Positives = 62/79 (78%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +KSESLV Sbjct: 3 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLV 62 Query: 70 IADQHVRGEYVPGSCTHRP 14 I DQ+ PG CTHRP Sbjct: 63 IVDQNATVNTFPGPCTHRP 81 >CSI43085.1 Uncharacterised protein [Shigella sonnei] GAS29422.1 hypothetical protein NGUA30_03271 [Salmonella enterica] GAR58412.1 hypothetical protein NGUA15_00146 [Salmonella enterica] CWZ50819.1 Uncharacterised protein [Salmonella enterica subsp. enterica serovar Typhi] CWZ90451.1 Uncharacterised protein [Salmonella enterica subsp. enterica serovar Typhi] Length = 92 Score = 102 bits (255), Expect = 6e-27 Identities = 54/73 (73%), Positives = 57/73 (78%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +KSESLV Sbjct: 3 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLV 62 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 63 IVDQNATVNTFPG 75 >EWS90747.1 hypothetical protein SSIG_01113 [Streptomyces roseosporus NRRL 11379] Length = 95 Score = 102 bits (255), Expect = 7e-27 Identities = 55/81 (67%), Positives = 56/81 (69%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS H PY LG TRATMA TM D AR S K S D LQLD +KSE LVI Sbjct: 12 RRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQLDPMKSELLVI 71 Query: 67 ADQHVRGEYVPGSCTHRPSHH 5 ADQH GEYVPG CTHRPS H Sbjct: 72 ADQHCCGEYVPGPCTHRPSRH 92 >EFF91834.1 conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 102 bits (255), Expect = 7e-27 Identities = 55/81 (67%), Positives = 56/81 (69%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS H PY LG TRATMA TM D R S K S D LQLD +KSESLVI Sbjct: 12 RRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVI 71 Query: 67 ADQHVRGEYVPGSCTHRPSHH 5 ADQH GEYVPG CTHRPS H Sbjct: 72 ADQHCCGEYVPGPCTHRPSRH 92 >EDX22403.1 conserved hypothetical protein [Streptomyces sp. Mg1] EFL16481.1 conserved hypothetical protein [Streptomyces sp. C] Length = 95 Score = 102 bits (255), Expect = 7e-27 Identities = 55/81 (67%), Positives = 56/81 (69%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS H PY LG TRATMA TM D R S K S D LQLD +KSESLVI Sbjct: 12 RRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVI 71 Query: 67 ADQHVRGEYVPGSCTHRPSHH 5 ADQH GEYVPG CTHRPS H Sbjct: 72 ADQHCCGEYVPGPCTHRPSRH 92 >AOE11689.1 hypothetical protein [uncultured bacterium] Length = 109 Score = 103 bits (256), Expect = 7e-27 Identities = 55/81 (67%), Positives = 57/81 (70%) Frame = -3 Query: 244 RKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVIA 65 RKVG TS+ HGPY LGHTRATM +T GS S K S DRSLQLD VK ESLVIA Sbjct: 14 RKVGTTSNHHGPYILGHTRATMVVTEGSHWVTRSKSLKHYLSSDRSLQLDFVKLESLVIA 73 Query: 64 DQHVRGEYVPGSCTHRPSHHG 2 Q RGEYVPG CTHRPS HG Sbjct: 74 HQPWRGEYVPGPCTHRPSSHG 94 >AAX67927.1 ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 106 Score = 102 bits (255), Expect = 1e-26 Identities = 54/73 (73%), Positives = 57/73 (78%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +KSESLV Sbjct: 17 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLV 76 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 77 IVDQNATVNTFPG 89 >ABE05727.1 hypothetical protein UTI89_C0218 [Escherichia coli UTI89] ABE09738.1 hypothetical protein UTI89_C4312 [Escherichia coli UTI89] ABE09853.1 hypothetical protein UTI89_C4437 [Escherichia coli UTI89] ABE09975.1 hypothetical protein UTI89_C4564 [Escherichia coli UTI89] Length = 106 Score = 102 bits (255), Expect = 1e-26 Identities = 54/73 (73%), Positives = 57/73 (78%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +KSESLV Sbjct: 17 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLV 76 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 77 IVDQNATVNTFPG 89 >ABE08379.1 hypothetical protein UTI89_C2923 [Escherichia coli UTI89] ABE09241.1 hypothetical protein UTI89_C3812 [Escherichia coli UTI89] ABI99684.1 conserved hypothetical protein [Escherichia coli APEC O1] ABJ02761.1 conserved hypothetical protein [Escherichia coli APEC O1] ABJ03226.1 conserved hypothetical protein [Escherichia coli APEC O1] ABJ03328.1 conserved hypothetical protein [Escherichia coli APEC O1] ABJ03469.1 conserved hypothetical protein [Escherichia coli APEC O1] EFJ76176.1 hypothetical protein HMPREF9552_00144 [Escherichia coli MS 198-1] EFK05103.1 hypothetical protein HMPREF9548_00105 [Escherichia coli MS 182-1] EFK17195.1 hypothetical protein HMPREF9541_00399 [Escherichia coli MS 116-1] EFK27371.1 hypothetical protein HMPREF9550_00464 [Escherichia coli MS 187-1] EFK74338.1 hypothetical protein HMPREF9535_01697 [Escherichia coli MS 78-1] EFK92618.1 hypothetical protein HMPREF9543_00498 [Escherichia coli MS 146-1] EGJ08671.1 hypothetical protein SSJG_04722 [Escherichia coli D9] ANK02891.1 Hypothetical protein WLH_01630 [Escherichia coli O25b:H4] ANK03752.1 Hypothetical protein WLH_02491 [Escherichia coli O25b:H4] Length = 121 Score = 102 bits (255), Expect = 1e-26 Identities = 54/73 (73%), Positives = 57/73 (78%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +KSESLV Sbjct: 32 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLV 91 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 92 IVDQNATVNTFPG 104 >EFJ63628.1 hypothetical protein HMPREF9553_00243, partial [Escherichia coli MS 200-1] CCJ46477.1 putative uncharacterized protein, partial [Escherichia coli] ETJ28699.1 ORF16-lacZ fusion protein, partial [Escherichia coli DORA_A_5_14_21] Length = 133 Score = 102 bits (255), Expect = 2e-26 Identities = 54/73 (73%), Positives = 57/73 (78%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +KSESLV Sbjct: 44 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLV 103 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 104 IVDQNATVNTFPG 116 >CIC34492.1 Uncharacterised protein [Salmonella enterica subsp. enterica serovar Typhi] Length = 92 Score = 101 bits (251), Expect = 3e-26 Identities = 53/73 (72%), Positives = 56/73 (76%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDL RASGPHKVRRSPD SLQLD +KSESLV Sbjct: 3 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLVRASGPHKVRRSPDWSLQLDSMKSESLV 62 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 63 IVDQNATVNTFPG 75 >EDY45007.2 conserved hypothetical protein [Streptomyces sp. SPB074] Length = 95 Score = 100 bits (249), Expect = 6e-26 Identities = 54/81 (66%), Positives = 55/81 (67%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS H PY LG TRATMA TM D R S K S D LQLD +KSE LVI Sbjct: 12 RRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSELLVI 71 Query: 67 ADQHVRGEYVPGSCTHRPSHH 5 ADQH GEYVPG CTHRPS H Sbjct: 72 ADQHCCGEYVPGPCTHRPSRH 92 >AAX64154.1 ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] AAX67708.1 ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] AAX67790.1 ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 106 Score = 100 bits (249), Expect = 8e-26 Identities = 53/73 (72%), Positives = 56/73 (76%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKVRRSPD SLQLD +K ESLV Sbjct: 17 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKLESLV 76 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 77 IVDQNATVNTFPG 89 >JAN31957.1 hypothetical protein [Daphnia magna] Length = 96 Score = 100 bits (248), Expect = 8e-26 Identities = 52/73 (71%), Positives = 54/73 (73%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 NRRKVGMTSSPHGPY G+TR TMA T G AR S HK RSPDRSLQLDCVKSESLV Sbjct: 7 NRRKVGMTSSPHGPYRWGYTRHTMAGTEGCQPARGSQSHKASRSPDRSLQLDCVKSESLV 66 Query: 70 IADQHVRGEYVPG 32 I DQ+V PG Sbjct: 67 IVDQNVTVNTFPG 79 >CCI74526.1 unnamed protein product [Klebsiella pneumoniae subsp. rhinoscleromatis SB3432] Length = 121 Score = 100 bits (249), Expect = 1e-25 Identities = 53/73 (72%), Positives = 56/73 (76%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKV RSPD SLQLD +KSESLV Sbjct: 32 NWRKVGMTSSHHGPYDQGYTRATMAYTKRSDLARASGPHKVCRSPDWSLQLDSMKSESLV 91 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 92 IVDQNATVNTFPG 104 >CDO12945.1 unnamed protein product [Klebsiella pneumoniae] Length = 127 Score = 100 bits (249), Expect = 1e-25 Identities = 53/73 (72%), Positives = 56/73 (76%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARASGPHKV RSPD SLQLD +KSESLV Sbjct: 38 NWRKVGMTSSHHGPYDQGYTRATMAYTKRSDLARASGPHKVCRSPDWSLQLDSMKSESLV 97 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 98 IVDQNATVNTFPG 110 >ABE09160.1 conserved hypothetical protein [Escherichia coli UTI89] ABJ02014.1 conserved hypothetical protein [Escherichia coli APEC O1] Length = 121 Score = 99.8 bits (247), Expect = 2e-25 Identities = 53/73 (72%), Positives = 56/73 (76%) Frame = -3 Query: 250 NRRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLV 71 N RKVGMTSS HGPY G+TRATMA T SDLARAS PHKVRRSPD SLQLD +KSESLV Sbjct: 32 NWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASEPHKVRRSPDWSLQLDSMKSESLV 91 Query: 70 IADQHVRGEYVPG 32 I DQ+ PG Sbjct: 92 IVDQNATVNTFPG 104 >EDY62143.2 conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 97.4 bits (241), Expect = 9e-25 Identities = 52/81 (64%), Positives = 54/81 (66%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS H PY LG TRATMA T + R S K S D LQLD +KSE LVI Sbjct: 12 RRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVI 71 Query: 67 ADQHVRGEYVPGSCTHRPSHH 5 ADQH GEYVPG CTHRPS H Sbjct: 72 ADQHCCGEYVPGPCTHRPSRH 92 >EDY48148.1 conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 96.7 bits (239), Expect = 2e-24 Identities = 52/81 (64%), Positives = 54/81 (66%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS H PY LG TRATMA T + R S K S D LQLD +KSE LVI Sbjct: 12 RRKVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQLDPMKSELLVI 71 Query: 67 ADQHVRGEYVPGSCTHRPSHH 5 ADQH GEYVPG CTHRPS H Sbjct: 72 ADQHCCGEYVPGPCTHRPSRH 92 >OCG19290.1 hypothetical protein A9G23_09380 [Gilliamella apicola] Length = 105 Score = 96.3 bits (238), Expect = 4e-24 Identities = 50/72 (69%), Positives = 54/72 (75%) Frame = -3 Query: 247 RRKVGMTSSPHGPYGLGHTRATMAITMGSDLARASGPHKVRRSPDRSLQLDCVKSESLVI 68 RRKVG TSS HGPY G+TRATMA T S+LAR SGPHKVR SPD SLQLD +KSESLVI Sbjct: 17 RRKVGTTSSHHGPYDQGYTRATMAYTKRSELARVSGPHKVRLSPDWSLQLDSMKSESLVI 76 Query: 67 ADQHVRGEYVPG 32 DQ+ PG Sbjct: 77 VDQNATVNTFPG 88