BLASTX nr result
ID: Glycyrrhiza29_contig00041257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00041257 (235 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU40976.1 hypothetical protein TSUD_300550 [Trifolium subterran... 62 6e-10 XP_019459800.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 62 8e-10 KYP45679.1 RING finger protein 44 [Cajanus cajan] 62 8e-10 XP_019438580.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 60 2e-09 XP_017429920.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [... 60 3e-09 KHN05193.1 E3 ubiquitin ligase BIG BROTHER-related [Glycine soja] 60 3e-09 KRH17980.1 hypothetical protein GLYMA_13G031100 [Glycine max] 60 3e-09 NP_001304424.1 E3 ubiquitin ligase BIG BROTHER-related-like [Gly... 60 3e-09 XP_019417360.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [... 60 4e-09 XP_014504240.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 60 4e-09 KYP55133.1 RING finger protein 44 [Cajanus cajan] 59 6e-09 XP_016179436.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 59 7e-09 XP_015944629.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 59 7e-09 KHN21712.1 E3 ubiquitin ligase BIG BROTHER-related [Glycine soja] 59 8e-09 XP_007161474.1 hypothetical protein PHAVU_001G072100g [Phaseolus... 59 9e-09 KHN33975.1 E3 ubiquitin ligase BIG BROTHER-related [Glycine soja... 59 9e-09 XP_012571866.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 60 9e-09 KRH53246.1 hypothetical protein GLYMA_06G113900 [Glycine max] 59 9e-09 XP_003602037.1 zinc finger, C3HC4 type (RING finger) protein [Me... 59 1e-08 XP_014500792.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-relate... 58 2e-08 >GAU40976.1 hypothetical protein TSUD_300550 [Trifolium subterraneum] Length = 208 Score = 62.0 bits (149), Expect = 6e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQK 149 PYHTDCI+KWLQIKKVCPICS+EVS P K Sbjct: 176 PYHTDCISKWLQIKKVCPICSNEVSTPNK 204 >XP_019459800.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Lupinus angustifolius] Length = 195 Score = 61.6 bits (148), Expect = 8e-10 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKVD 143 PYHTDCI+KWLQIKKVCPICS E+SVP V+ Sbjct: 162 PYHTDCISKWLQIKKVCPICSIEISVPNMVN 192 >KYP45679.1 RING finger protein 44 [Cajanus cajan] Length = 201 Score = 61.6 bits (148), Expect = 8e-10 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCITKWLQIKKVCPIC++E+S P+ V Sbjct: 171 PYHTDCITKWLQIKKVCPICNTEISAPKMV 200 >XP_019438580.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Lupinus angustifolius] OIW14500.1 hypothetical protein TanjilG_12093 [Lupinus angustifolius] Length = 200 Score = 60.5 bits (145), Expect = 2e-09 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYH DCITKWLQ+KKVCPICS+EVS P+ V Sbjct: 166 PYHKDCITKWLQVKKVCPICSNEVSAPKMV 195 >XP_017429920.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Vigna angularis] KOM48528.1 hypothetical protein LR48_Vigan07g223200 [Vigna angularis] BAT82096.1 hypothetical protein VIGAN_03205300 [Vigna angularis var. angularis] Length = 203 Score = 60.1 bits (144), Expect = 3e-09 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKVD 143 PYHTDCI+KWLQIKKVCPIC++E+S P+ V+ Sbjct: 173 PYHTDCISKWLQIKKVCPICNTEISAPKVVN 203 >KHN05193.1 E3 ubiquitin ligase BIG BROTHER-related [Glycine soja] Length = 203 Score = 60.1 bits (144), Expect = 3e-09 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCI+KWLQIKKVCPIC++E+S P+ V Sbjct: 173 PYHTDCISKWLQIKKVCPICNTEISAPKMV 202 >KRH17980.1 hypothetical protein GLYMA_13G031100 [Glycine max] Length = 203 Score = 60.1 bits (144), Expect = 3e-09 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCI+KWLQIKKVCPIC++E+S P+ V Sbjct: 173 PYHTDCISKWLQIKKVCPICNTEISAPKMV 202 >NP_001304424.1 E3 ubiquitin ligase BIG BROTHER-related-like [Glycine max] ACU24020.1 unknown [Glycine max] Length = 203 Score = 60.1 bits (144), Expect = 3e-09 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCI+KWLQIKKVCPIC++E+S P+ V Sbjct: 173 PYHTDCISKWLQIKKVCPICNTEISAPKMV 202 >XP_019417360.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Lupinus angustifolius] OIV96665.1 hypothetical protein TanjilG_09207 [Lupinus angustifolius] Length = 195 Score = 59.7 bits (143), Expect = 4e-09 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQ 152 PYHTDCI KWLQIKKVCPICS+EVS P+ Sbjct: 161 PYHTDCIIKWLQIKKVCPICSNEVSAPK 188 >XP_014504240.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Vigna radiata var. radiata] Length = 202 Score = 59.7 bits (143), Expect = 4e-09 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCI+KWLQIKKVCPIC++E+S P+ V Sbjct: 172 PYHTDCISKWLQIKKVCPICNTEISAPKVV 201 >KYP55133.1 RING finger protein 44 [Cajanus cajan] Length = 200 Score = 59.3 bits (142), Expect = 6e-09 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYH DCI+KWLQIKKVCPICS+EVS P V Sbjct: 168 PYHADCISKWLQIKKVCPICSNEVSTPNMV 197 >XP_016179436.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Arachis ipaensis] Length = 210 Score = 59.3 bits (142), Expect = 7e-09 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKVD 143 P+HTDCI+KWLQ++KVCPICSSE+S P+ V+ Sbjct: 173 PFHTDCISKWLQVRKVCPICSSEISAPEIVN 203 >XP_015944629.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Arachis duranensis] Length = 210 Score = 59.3 bits (142), Expect = 7e-09 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKVD 143 P+HTDCI+KWLQ++KVCPICSSE+S P+ V+ Sbjct: 173 PFHTDCISKWLQVRKVCPICSSEISAPEIVN 203 >KHN21712.1 E3 ubiquitin ligase BIG BROTHER-related [Glycine soja] Length = 175 Score = 58.5 bits (140), Expect = 8e-09 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVP 155 PYH+DCI+KWLQIKKVCPICS+EVS P Sbjct: 143 PYHSDCISKWLQIKKVCPICSNEVSTP 169 >XP_007161474.1 hypothetical protein PHAVU_001G072100g [Phaseolus vulgaris] ESW33468.1 hypothetical protein PHAVU_001G072100g [Phaseolus vulgaris] Length = 202 Score = 58.9 bits (141), Expect = 9e-09 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCI+KWLQ+KKVCPIC++E+S P+ V Sbjct: 172 PYHTDCISKWLQMKKVCPICNTEISAPKMV 201 >KHN33975.1 E3 ubiquitin ligase BIG BROTHER-related [Glycine soja] KRH16389.1 hypothetical protein GLYMA_14G152800 [Glycine max] Length = 205 Score = 58.9 bits (141), Expect = 9e-09 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQKV 146 PYHTDCI+KWLQIKKVCPIC+ E+S P+ V Sbjct: 175 PYHTDCISKWLQIKKVCPICNIEISAPKMV 204 >XP_012571866.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Cicer arietinum] Length = 287 Score = 59.7 bits (143), Expect = 9e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQK 149 PYH DCI+KWLQIKKVCPICS+EVS P K Sbjct: 255 PYHKDCISKWLQIKKVCPICSNEVSTPNK 283 >KRH53246.1 hypothetical protein GLYMA_06G113900 [Glycine max] Length = 183 Score = 58.5 bits (140), Expect = 9e-09 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVP 155 PYH+DCI+KWLQIKKVCPICS+EVS P Sbjct: 151 PYHSDCISKWLQIKKVCPICSNEVSTP 177 >XP_003602037.1 zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] AES72288.1 zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] Length = 211 Score = 58.9 bits (141), Expect = 1e-08 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVPQK 149 PYHTDCI+KWLQIKKVCPICS+EVS K Sbjct: 179 PYHTDCISKWLQIKKVCPICSNEVSTTNK 207 >XP_014500792.1 PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Vigna radiata var. radiata] Length = 194 Score = 58.2 bits (139), Expect = 2e-08 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = -1 Query: 235 PYHTDCITKWLQIKKVCPICSSEVSVP 155 PYH DCI+KWLQIKKVCPICS+EVS P Sbjct: 162 PYHADCISKWLQIKKVCPICSNEVSTP 188