BLASTX nr result
ID: Glycyrrhiza29_contig00041247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00041247 (577 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN41721.1 Pentatricopeptide repeat-containing protein, mitochon... 81 1e-14 XP_014628080.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 5e-12 KRG90497.1 hypothetical protein GLYMA_20G094700 [Glycine max] 74 5e-12 XP_004511762.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-06 >KHN41721.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 737 Score = 81.3 bits (199), Expect = 1e-14 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 458 HRSNHSQPSKPPLPFTRKSECDESLLLHYLMKGWHHEA*ELLQSFFGGDRHARVV 294 +R NHS+P KPP PF +++ECDESLLLHYL GWH +A LLQ+ GGD H+RVV Sbjct: 32 YRVNHSRPRKPPFPFPKRTECDESLLLHYLSNGWHDDARNLLQNSSGGDLHSRVV 86 >XP_014628080.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628081.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628082.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628084.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628086.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628088.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628089.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] Length = 766 Score = 73.9 bits (180), Expect = 5e-12 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = -3 Query: 458 HRSNHSQPSKPPLPFTRKSECDESLLLHYLMKGWHHEA*ELLQSFFGGDRHARVV 294 +R NHS+P K P PF +++ECDESLLLHYL GW ++A LLQ+ GGD H RVV Sbjct: 61 YRINHSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDLHLRVV 115 >KRG90497.1 hypothetical protein GLYMA_20G094700 [Glycine max] Length = 894 Score = 73.9 bits (180), Expect = 5e-12 Identities = 33/55 (60%), Positives = 41/55 (74%) Frame = -3 Query: 458 HRSNHSQPSKPPLPFTRKSECDESLLLHYLMKGWHHEA*ELLQSFFGGDRHARVV 294 +R NHS+P K P PF +++ECDESLLLHYL GW ++A LLQ+ GGD H RVV Sbjct: 61 YRINHSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDLHLRVV 115 >XP_004511762.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Cicer arietinum] Length = 741 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -3 Query: 452 SNHSQPSKPPLPFTRKSECDESLLLHYLMKGWHHEA*ELLQSFFGGDRHARVV 294 SNHS KP PF K E DES L HYL KG HHEA ++LQ+F + H RVV Sbjct: 27 SNHSHSFKPLFPFPPKHEFDESQLFHYLTKGLHHEARKILQTFPCKNPHTRVV 79