BLASTX nr result
ID: Glycyrrhiza29_contig00040783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040783 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007137504.1 hypothetical protein PHAVU_009G132500g [Phaseolus... 77 4e-14 KRH64586.1 hypothetical protein GLYMA_04G243400 [Glycine max] 77 5e-14 KHN44280.1 Pentatricopeptide repeat-containing protein [Glycine ... 77 5e-14 KRH64585.1 hypothetical protein GLYMA_04G243400 [Glycine max] 77 5e-14 XP_003522563.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 5e-14 XP_019438612.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-13 XP_013461346.1 PPR containing plant-like protein [Medicago trunc... 74 4e-13 BAT78730.1 hypothetical protein VIGAN_02145100 [Vigna angularis ... 73 1e-12 XP_017419707.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 XP_014522309.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 1e-12 XP_004502560.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 7e-12 XP_015947188.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-11 XP_015942531.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 2e-11 XP_007201795.1 hypothetical protein PRUPE_ppa003245mg [Prunus pe... 57 5e-07 ONH89667.1 hypothetical protein PRUPE_8G008000 [Prunus persica] 57 5e-07 XP_018808034.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 7e-07 XP_008244565.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 XP_011027417.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 6e-06 XP_002302207.1 pentatricopeptide repeat-containing family protei... 54 6e-06 XP_015888478.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 8e-06 >XP_007137504.1 hypothetical protein PHAVU_009G132500g [Phaseolus vulgaris] ESW09498.1 hypothetical protein PHAVU_009G132500g [Phaseolus vulgaris] Length = 693 Score = 77.4 bits (189), Expect = 4e-14 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 L+NFM+TMTIEPT+PML+R LDACQ+NE RLGEWITEKIN F++ Sbjct: 649 LDNFMRTMTIEPTLPMLERVLDACQKNEWARLGEWITEKINAFKY 693 >KRH64586.1 hypothetical protein GLYMA_04G243400 [Glycine max] Length = 485 Score = 77.0 bits (188), Expect = 5e-14 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMT+EPT+PMLKR LD CQ+NE RLGEWI EKINEF++ Sbjct: 441 LENFMRTMTMEPTLPMLKRVLDVCQKNECPRLGEWIAEKINEFKY 485 >KHN44280.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 576 Score = 77.0 bits (188), Expect = 5e-14 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMT+EPT+PMLKR LD CQ+NE RLGEWI EKINEF++ Sbjct: 532 LENFMRTMTMEPTLPMLKRVLDVCQKNECPRLGEWIAEKINEFKY 576 >KRH64585.1 hypothetical protein GLYMA_04G243400 [Glycine max] Length = 677 Score = 77.0 bits (188), Expect = 5e-14 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMT+EPT+PMLKR LD CQ+NE RLGEWI EKINEF++ Sbjct: 633 LENFMRTMTMEPTLPMLKRVLDVCQKNECPRLGEWIAEKINEFKY 677 >XP_003522563.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Glycine max] Length = 698 Score = 77.0 bits (188), Expect = 5e-14 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMT+EPT+PMLKR LD CQ+NE RLGEWI EKINEF++ Sbjct: 654 LENFMRTMTMEPTLPMLKRVLDVCQKNECPRLGEWIAEKINEFKY 698 >XP_019438612.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Lupinus angustifolius] OIW14466.1 hypothetical protein TanjilG_19882 [Lupinus angustifolius] Length = 697 Score = 75.1 bits (183), Expect = 2e-13 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LE F+KTM I+PTI ML RALDACQ+NE RLGEWI EKINEF+H Sbjct: 653 LERFIKTMPIDPTISMLTRALDACQKNEHARLGEWIAEKINEFQH 697 >XP_013461346.1 PPR containing plant-like protein [Medicago truncatula] KEH35381.1 PPR containing plant-like protein [Medicago truncatula] Length = 698 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LE+FMKTMTIEPT+PML+RALDACQ+N+ LG+WI +KI+EFEH Sbjct: 654 LESFMKTMTIEPTLPMLERALDACQKNDSPILGKWIAKKIHEFEH 698 >BAT78730.1 hypothetical protein VIGAN_02145100 [Vigna angularis var. angularis] Length = 483 Score = 73.2 bits (178), Expect = 1e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMTIEPT+PML+R LDACQ+NE RLGE ITEKIN F++ Sbjct: 439 LENFMRTMTIEPTLPMLERVLDACQKNEWSRLGECITEKINAFKY 483 >XP_017419707.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Vigna angularis] KOM41489.1 hypothetical protein LR48_Vigan04g168700 [Vigna angularis] Length = 692 Score = 73.2 bits (178), Expect = 1e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMTIEPT+PML+R LDACQ+NE RLGE ITEKIN F++ Sbjct: 648 LENFMRTMTIEPTLPMLERVLDACQKNEWSRLGECITEKINAFKY 692 >XP_014522309.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Vigna radiata var. radiata] Length = 693 Score = 73.2 bits (178), Expect = 1e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFM+TMTIEPT+PML+R LDACQ+NE RLGE ITEKIN F++ Sbjct: 649 LENFMRTMTIEPTLPMLERVLDACQKNEWSRLGECITEKINAFKY 693 >XP_004502560.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Cicer arietinum] XP_012571888.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Cicer arietinum] XP_012571889.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Cicer arietinum] Length = 682 Score = 70.9 bits (172), Expect = 7e-12 Identities = 35/48 (72%), Positives = 39/48 (81%), Gaps = 3/48 (6%) Frame = +3 Query: 3 LENFMKT---MTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENFMKT MTIEPT+ ML+RALDACQ++E LG WI EKINEFEH Sbjct: 635 LENFMKTLKTMTIEPTLSMLERALDACQKHESPSLGSWIAEKINEFEH 682 >XP_015947188.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540-like [Arachis duranensis] Length = 697 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENF+KTM IEPT+ ML+RA +A Q+N RLGEWIT K+NEFEH Sbjct: 653 LENFLKTMPIEPTLSMLRRAFEASQKNRYSRLGEWITHKLNEFEH 697 >XP_015942531.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540-like [Arachis duranensis] Length = 697 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINEFEH 137 LENF+KTM IEPT+ ML+RA +A Q+N RLGEWIT K+NEFEH Sbjct: 653 LENFLKTMPIEPTLSMLRRAFEASQKNRYSRLGEWITHKLNEFEH 697 >XP_007201795.1 hypothetical protein PRUPE_ppa003245mg [Prunus persica] Length = 589 Score = 57.0 bits (136), Expect = 5e-07 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LENF+K M +PT+PML R LDAC+ + LRLG+W +++NE Sbjct: 548 LENFVKNMPFDPTVPMLTRVLDACRRHGCLRLGQWAAQRLNE 589 >ONH89667.1 hypothetical protein PRUPE_8G008000 [Prunus persica] Length = 693 Score = 57.0 bits (136), Expect = 5e-07 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LENF+K M +PT+PML R LDAC+ + LRLG+W +++NE Sbjct: 652 LENFVKNMPFDPTVPMLTRVLDACRRHGCLRLGQWAAQRLNE 693 >XP_018808034.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Juglans regia] XP_018808035.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Juglans regia] XP_018808036.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Juglans regia] XP_018808037.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Juglans regia] Length = 707 Score = 56.6 bits (135), Expect = 7e-07 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LENF+K M EPT+PML DAC+++ +RLGEW E++N+ Sbjct: 650 LENFVKNMAFEPTVPMLMSVFDACRKHGHIRLGEWAAERLNQ 691 >XP_008244565.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Prunus mume] XP_016652348.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Prunus mume] XP_016652349.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Prunus mume] XP_016652350.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Prunus mume] XP_016652351.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Prunus mume] Length = 693 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LE+F+K M +PT+PML R LDAC+ + LRLG+W +++NE Sbjct: 652 LEDFVKNMPFDPTVPMLTRILDACRRHGCLRLGQWAAQRLNE 693 >XP_011027417.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Populus euphratica] Length = 709 Score = 53.9 bits (128), Expect = 6e-06 Identities = 21/42 (50%), Positives = 33/42 (78%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LENF+K M +PT+PML R +DAC++++ RLGEW ++++E Sbjct: 648 LENFIKDMPFDPTVPMLTRVVDACKKHQCWRLGEWAAKRLDE 689 >XP_002302207.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] EEE81480.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 709 Score = 53.9 bits (128), Expect = 6e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LENF+K M +PT PML R +DAC+E++ RLGEW ++++E Sbjct: 648 LENFIKDMPFDPTAPMLTRVVDACKEHQCWRLGEWAAKRLDE 689 >XP_015888478.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26540 [Ziziphus jujuba] Length = 686 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = +3 Query: 3 LENFMKTMTIEPTIPMLKRALDACQENERLRLGEWITEKINE 128 LENF+KTM EPT+ ML + LDA +++ LR+G+W E++NE Sbjct: 644 LENFIKTMPFEPTVSMLTKVLDASRKHGHLRMGKWAAERLNE 685